!!NA_SEQUENCE 1.0
ID   BNYVVR3B   standard; RNA; VRL; 1420 BP.
XX
AC   M36895;
XX
SV   M36895.1
XX
DT   31-AUG-1990 (Rel. 25, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 4)
XX
DE   Beet necrotic yellow vein mosaic virus G1 RNA-3.
XX
KW   .
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-1420
RA   Bouzoubaa S., Guilley H., Jonard G., Richards K., Putz C.;
RT   "nucleotide sequence analysis of rna-3 and rna-4 of beet necrotic yellow
RT   vein virus, isolates f2 and g1";
RL   J. Gen. Virol. 66:1553-1564(1985).
XX
DR   SWISS-PROT; P19230; Y12K_BNYVG.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1420
FT                   /db_xref="taxon:31721"
FT                   /organism="Beet necrotic yellow vein virus"
FT   CDS             446. .751
FT                   /codon_start=1
FT                   /db_xref="SWISS-PROT:P19230"
FT                   /note="viral ORF"
FT                   /protein_id="AAA42799.1"
FT                   /translation="MGDILGAVYDLGHRPYLARRTVYEDRLILSTHGNICRAINLLTHD
FT                   NRTTLVYHNNTKRIRFRGLLCALHGPYCGFRALCRVMLCSLPRLCDIPIRLVDDDD"
XX
SQ   Sequence 1420 BP; 373 A; 237 C; 293 G; 517 T; 0 other;

M36895  Length: 1420  December 21, 2001 15:55  Type: N  Check: 4617  ..
       1  gaaattcaaa atttaccatt acatattggt atttatttac cctcagttgg
      51  tgatatatgt gaggacgcta gcctgttggg tttcctgacc gaccaaatcc
     101  aagcgagctt aatccaagta cctcgtctca aattgagtgt caagtgaata
     151  agcatagtga ccccatcgtt tcagggtagt tgacggctat taatagacat
     201  attacaaacg cttctcttta tttatcacca acatgggatg taatgtttat
     251  gcgtgagcta cggccgcatt gtaaaattag tggttttgaa tttctattct
     301  tcggaatata caaggtttaa aagaccagca tttgggttaa aaatttttaa
     351  accttactat cttcaactag taactcgaac ttgatttata ttcagatttt
     401  aaatatcaag ttgttgtgtt ttctgatcat cattaagtga ccgtcatggg
     451  tgatatatta ggcgcagttt atgatttagg gcacagacct tacctagcac
     501  ggcgtacggt ttatgaggat cgtttgattc ttagcacaca tggtaatatc
     551  tgtcgggcta ttaacttgtt aactcacgat aatcgtacta cactggtgta
     601  tcacaataat actaaacgca taaggtttcg tggattattg tgtgctcttc
     651  atgggcctta ttgtgggttt cgtgccttat gtagagtaat gttatgttct
     701  ctacctcgtt tgtgtgacat ccctatcaga ctcgttgatg atgatgatta
     751  gagttatcac aatttcaaca acacacttat tggtgtgttg ttctgttaca
     801  ccatttgaaa gtttaataat tgtctcaatt cgattgttga tctggttggg
     851  acaattattt tattttcttt tggtgtaatc gtccgaagac gttaaactac
     901  acgtgatttc acggtgttcg atgagaagat tgtttaacgg tgttacgttg
     951  tgtaccttta agctttcttc tcatttaacc acatgtgatg attgtagcct
    1001  gtgggttgtt atgtggacaa ttatggttac ttatttgtaa atgataaaga
    1051  gtgtgcggta gcgactttat gcgagtggga gtagttgtgt tattactact
    1101  attctggttc gtataaagat ccttgacggc ggcatcgtgg gttccacagc
    1151  cggttacatg gtgttcccgt ccgtttacga aggtttaact gtgagccttg
    1201  tattttacaa atacacagtt tttatcttaa caggctcgtt cacaagcctc
    1251  cttttacatt aagtttaaag gtttatgtgg acacaaaaat atggcttatt
    1301  ggttatgcta aacctcatat catgttataa tattcgtttc atattataat
    1351  taaggttaag atgtactgac tgggtgtgaa atgtaccagt ccttgtaggg
    1401  ttctttgtca gtatattgac