!!NA_SEQUENCE 1.0
ID   BNYVVR4A   standard; RNA; VRL; 1108 BP.
XX
AC   M36896;
XX
SV   M36896.1
XX
DT   31-AUG-1990 (Rel. 25, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 3)
XX
DE   Beet necrotic yellow vein mosaic virus F2 RNA-4.
XX
KW   .
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-1108
RA   Bouzoubaa S., Guilley H., Jonard G., Richards K., Putz C.;
RT   "nucleotide sequence analysis of rna-3 and rna-4 of beet necrotic yellow
RT   vein virus, isolates f2 and g1";
RL   J. Gen. Virol. 66:1553-1564(1985).
XX
DR   SPTREMBL; Q65686; Q65686.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1108
FT                   /db_xref="taxon:31721"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /isolate="F2"
FT   CDS             344. .751
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q65686"
FT                   /note="ORF; putative"
FT                   /product="unknown protein"
FT                   /protein_id="AAA69656.1"
FT                   /translation="MADGEICRCQVTDLPLIRHEDYDCTARMVQKRIEIGPLGVLLNLN
FT                   MLFHMSRVRHTDVYPYLNNIMSISVSLDVPVSSGVGVGRVRVLIFTTSRERVGIFHGWQ
FT                   VVPGCFLNAPCYSGVDVLSDELCEANNLGQC"
XX
SQ   Sequence 1108 BP; 270 A; 167 C; 260 G; 411 T; 0 other;

M36896  Length: 1108  December 21, 2001 15:55  Type: N  Check: 8364  ..
       1  gattgtctgt aaaacaattc cagttgtttg tctgtaaaac aaacatgtat
      51  gcttgatcag ctttgtagat ccttgattat caactttatt tctatcattg
     101  aattcgaatt gtttctgttg agattctctt tacgatttgt gtcgtcattt
     151  cgtatattgg aagacgggcc tgattccagt attaattggt cagtttatag
     201  gtgcagaacg cttttaagtg agacctaaga ctgcgtcgga accttagatt
     251  cacgagccgc gtgattaatt gggtttgtca ctgggatcca gtctatcagt
     301  aaggggtagt cttttgttga gacttatctg attagtaaca cttatggctg
     351  atggagagat atgtcggtgt caggttactg atcttccctt gatacgtcat
     401  gaagactatg attgtactgc taggatggtg cagaaacgga ttgagattgg
     451  cccattgggt gttttactca atcttaacat gttatttcat atgtctcgtg
     501  ttagacatac tgatgtttat ccgtatctga ataatattat gtctatttcg
     551  gtgtcgttgg atgttcctgt gtctagtggc gttggcgttg gacgtgtacg
     601  tgttttaata tttacaacta gtcgtgaacg tgttggtata ttccatggat
     651  ggcaggttgt gcctgggtgc tttcttaatg ccccgtgtta tagtggtgtt
     701  gatgttctgt ctgatgagct atgtgaagct aataaccttg gacagtgtta
     751  acactctaac aaaagaaggg tggcgaaggt tttgtgatgt tctttggaat
     801  accacttatg gtgatgttga gtctcgtact tttgcacgct ttctgtggtt
     851  tgtcttttat cacgattagt ggtatttatg atgtgtttag ttattcgaga
     901  tacaagaata ataatatgta taattgtact attaacgggc tcgttcacaa
     951  gcctccttgc tatggtaagg tttatgtgaa cacaaaaata tggcttattg
    1001  gttatgctaa acctcatatc gtataaatat atataagtta aggttgagat
    1051  gtactgactg ggtgtgaaat gtaccagtct ttatagggtt ctctgtcagt
    1101  atattgac