!!NA_SEQUENCE 1.0
ID   BNYVVR4B   standard; RNA; VRL; 1370 BP.
XX
AC   M36897;
XX
SV   M36897.1
XX
DT   31-AUG-1990 (Rel. 25, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 4)
XX
DE   Beet necrotic yellow vein mosaic virus G1 RNA-4.
XX
KW   .
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-1370
RA   Bouzoubaa S., Guilley H., Jonard G., Richards K., Putz C.;
RT   "nucleotide sequence analysis of rna-3 and rna-4 of beet necrotic yellow
RT   vein virus, isolates f2 and g1";
RL   J. Gen. Virol. 66:1553-1564(1985).
XX
DR   SWISS-PROT; P19231; Y32K_BNYVG.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1370
FT                   /db_xref="taxon:31721"
FT                   /organism="Beet necrotic yellow vein virus"
FT   CDS             283. .1131
FT                   /codon_start=1
FT                   /db_xref="SWISS-PROT:P19231"
FT                   /note="viral ORF"
FT                   /protein_id="AAA42800.1"
FT                   /translation="MADGEICRCQVTDPPLIRHEDYDCTARMVQKRIEIGPLGVLLNLN
FT                   MLFHMSRVRHTDVYPCLNNIMSVSVSLDVPVSSGVGVGRARVLIFTTSRERVGIFHGWQ
FT                   VVPGCFLNAPCYSGVDVLSDELCEANIINTSVSSVAMFNRSYKPEDVWILLLTSSTCYG
FT                   YHDVVVDIEQCTLPSNIDGCVHCSGVCYFNDNHCFCGRRDSNPSNPPCFQFIKDCNELY
FT                   GTNETKQFICDLVGDANLDSVNTLTKEGWRRFCDVLWNTTYGDVESRTFARFLWFVFYH
FT                   D"
XX
SQ   Sequence 1370 BP; 331 A; 201 C; 316 G; 522 T; 0 other;

M36897  Length: 1370  December 21, 2001 15:55  Type: N  Check: 5275  ..
       1  tttgtagatc cttgattatc aactttattt ctatcattga atttgaattg
      51  tttctgttgc gattctcttt acgatttgtg tcgtcatttc gtatattgga
     101  agacgagtct gattccagta ttaattggtc agtttatagg tgcagaacgc
     151  ttttaagtga gacctgagac tgcgtcggaa ccttagattc acgagccgcg
     201  tgattaattg ggtttgtcac tgggatccag tctatcagta aggggtagtc
     251  ttttgttgag acttatctgt ttagtaacat ttatggctga tggagagata
     301  tgtcggtgtc aggttactga tcctcctttg atacgtcatg aagactatga
     351  ttgtactgct aggatggtgc agaaacggat tgagattggc ccattgggtg
     401  ttttactcaa tctaaacatg ttatttcata tgtctcgtgt tagacatact
     451  gatgtttatc cgtgtctgaa taatattatg tctgtttcgg tgtcgttgga
     501  tgttcctgtg tctagtggcg ttggtgttgg acgtgcacgt gttttaatat
     551  ttacaactag tcgtgaacgt gttggtatat tccatggatg gcaggttgtg
     601  cctgggtgct ttcttaatgc cccgtgttat agtggtgttg atgttctgtc
     651  tgatgagtta tgtgaagcta atattatcaa tacttcggtt tcgtctgttg
     701  cgatgttcaa taggtcgtat aaacccgaag acgtctggat actattactt
     751  acgtctagta cttgttatgg ttatcatgat gttgttgttg atatagaaca
     801  atgcacatta ccttctaata tagatgggtg tgttcattgt tctggtgttt
     851  gctatttcaa tgataatcat tgtttttgtg gtcgtcgtga tagtaatcca
     901  tccaatccgc cttgttttca atttattaaa gattgtaatg agttgtatgg
     951  aacaaatgaa actaaacaat tcatttgtga cctcgttggt gatgctaact
    1001  tggacagtgt taatactcta acaaaggaag ggtggcgaag gttttgtgat
    1051  gttctttgga ataccactta tggtgatgtt gagtctcgta cttttgcacg
    1101  ctttctgtgg tttgtctttt atcacgatta gtggtattta tgatgtgttt
    1151  agttattcga gatacaagaa taataatatg tataattgta ctattaacgg
    1201  gctcgttcac aagcctcctt gctatggtaa ggtttatgtg aacacaaaaa
    1251  tatggcttat tggttatgct aaacctcata tcgtataaat atatataagt
    1301  taaggttgag atgtactgac tgggtgtgaa atgtaccagt ctttataggg
    1351  ttctctgtca gtatattgac