ID   M58152; SV 1; linear; genomic RNA; STD; VRL; 7555 BP.
XX
AC   M58152; M31714;
XX
DT   01-AUG-1991 (Rel. 28, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Apple chlorotic leaf spot virus, complete genome.
XX
KW   coat protein.
XX
OS   Apple chlorotic leaf spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Flexiviridae;
OC   Trichovirus.
XX
RN   [1]
RP   1-7555
RX   PUBMED; 2219716.
RA   German S., Candresse T., Lanneau M., Huet J.C., Pernollet J.C., Dunez J.;
RT   "Nucleotide sequence and genomic organization of apple chlorotic leaf spot
RT   closterovirus.";
RL   Virology 179(1):104-112(1990).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .7555
FT                   /organism="Apple chlorotic leaf spot virus"
FT                   /strain="P863"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:12175"
FT   CDS             152. .5806
FT                   /codon_start=1
FT                   /label=ORF_1
FT                   /note="putative"
FT                   /db_xref="GOA:P27738"
FT                   /db_xref="InterPro:IPR000606"
FT                   /db_xref="InterPro:IPR001788"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR008744"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27738"
FT                   /protein_id="AAA42587.1"
FT                   /translation="MAFSYRTPQEELLSRLPQSQQEVISGFQYERIQKEEEKKVENFSF
FT                   YLPEKTREWFTKSGVYLSPFAYVNHSHPGCKTLENHLLFNVVASYISKYSYVACLSIKS
FT                   NKMSKMERLGPNSVKTYDILNRLVTAKDKARYGPLAKPERSPCPKKTNIFIHDEIHYWS
FT                   RDQLETFLQVHRPKNLWATLVFPPEILAGYKSSVLPFLYQFEIHGKDLVYMPDGVRSES
FT                   YTQPLENGFLLSSSSIIIKNRVTGVEIRYQVSLVYSLGSHHLFHIYPAEDLMKEEVRRF
FT                   GPYDLFDVGSLFVKPVRVPIQDFPLSVFKKIFIYMSSLKKPDVQSAVAKLRQLSDADIS
FT                   IESVFMIQEFASRIEKNGVESWSCSFWGCMKDWFFDKLPYREVLEKIGLADDFTRRLMK
FT                   IKPLAFDIHTTDRPLTVRMIIDQIWEERLSSFDNISNIVFYGRREWLNNGVLPKVKKKG
FT                   LAKLIPGREVDSHNYPREIYSDLLSSTSIWRSYDDDFRHRSASPLVILRSNRAYSEAAK
FT                   FSSNCLSLCAAPCDEVIARTPFELNHRREKKELSLKCLDFHIKKMKVKNVLELEVKLRE
FT                   RNTRISLSKKGVKKAGRSRMIPVHLLKPTCGEGNGKPEERNKEEAKIPMNEGTSKEEKG
FT                   SEPPHSEVKREGVRLDEQHISEPLLSFKLDDFVGREKLCSAGLIKTVGNDYLLLARQIE
FT                   CMPLSQLRGKKAAYFCLDFPMVYFHDKVSYPTFEATGEIRHVMMKARSKWGIDFNSALI
FT                   QVYNDGCRLPLHSDNEECYDDDGILTINVVGDAKFHTTCHDEVIDLKQGNEILMPAGYQ
FT                   KKNRHAVEVASEGRTSVTLRVHKRDFSFESKLRFIKGKFDCLFVSVAEIIHKKPEEIMM
FT                   FIPHIMDRCVSNRGCSLDDAKAICEKYEIKIECEGDCGLVECGTSGLSIGRMLLRGNHF
FT                   SVASVRRSSMDSLANSSKEIKSDGVLDHVTFNFHKRLKLVEPDLTNADIKVDSSRAGKL
FT                   LKSLMDGMTGIVSHNSTHEGWRMIKGINSTSEMRSFMNMVRGQIEEPKSDLFDKVQELN
FT                   FMKVKIYGIFGFAGSGKSHAIQNLIQTEFKGSQGIMVICPRRFLAKDWSEKGVDEKDIK
FT                   TFESALKSDVKGKRLFILDEISLLPKGFTDLLMLKMHMEGILKKSTIVCIGDPLQAGYF
FT                   CPKDDNYLSREGEIKRLFKGGVNYKWYSYRINKFIAKKLAIETMNDFIGIDEQSSIYKD
FT                   MPSAHHFMEKKGNHIEVILVASMVEKELYSNYGNVMTFGESQGLTFNCGVIVLSEEAKL
FT                   CSDAHIMVAITRFRRGFCFALGSKGSKEDYMRSMKSGLLQRICSGVGASKEFILGSSSV
FT                   NLILSEKDIAKGAGIDEMDREARLEGDVWLKSMIYLGKRYHMVEPLGQVIKLTDDAIKC
FT                   HIPVCSSQTLGPELDNIQAREYREFKGKNGWSNQFREEAGPNWKFPYKVNQAMSYEAVY
FT                   PRHKMDDDLTFLAAIKKRLRFDNVANNYAKFKAAESRGKYLTKIFLKHVPIKCGRDQRL
FT                   LDQCRQEFEETKLSKSAATIGAHSQRSDSDWPLDKIFLFMKSQLCTKFEKRFTEAKAGQ
FT                   TLACFPHKILVEFSPWCRYTEKVLTANLPDNYYIHQRKNFSELEDFARRFSNGSICVES
FT                   DYTAFDVSQDHTILAFEVELLRHFGWDDRVLQSYIKMKCTLGCRLGGFAIMRFTGEFST
FT                   FLFNTLANMVFTFCRYEVPDGTPICFAGDDMCALRNLREIDTHEFILSKLSLKAKVNRT
FT                   KVPMFCGWRLCCDGLIKEPCLIYERLQVAIENGRLMDVIDSYFLEFSFAYKLGERLYSH
FT                   LEIEQLNYHQVLTRFFIRNKHLLRGDSRHNISELEWLSDEDGDNDKGSQIEDRRRGYSN
FT                   CWGEKLQNLF"
FT   CDS             5718. .7100
FT                   /codon_start=1
FT                   /label=ORF_2
FT                   /note="putative"
FT                   /db_xref="GOA:P27739"
FT                   /db_xref="InterPro:IPR001022"
FT                   /db_xref="InterPro:IPR001815"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27739"
FT                   /protein_id="AAA42588.1"
FT                   /translation="MATMIRGHRLRIAEGDIPIAGVKSSRIYSDISPFKKASDLMIHWN
FT                   EFVFKVMPEDIAGDGFRLASIPVIPSSEVQAVLRKRESTNYVHWGALSISIDALFRKNA
FT                   GVSGWCYVYDNRWETFEQAMLQKFHFNLDSGSATLVTSPNFPVSLDDPGLSNSISVAVM
FT                   FENLNFKFESYPISVRVGNMCRFFDSFLSSVKNKVDSNFLLEASNADPLGVGAFGFEQD
FT                   DQVSELFNYIQTVPTQAIKFREHEIPKGFLGMMGKKKIKSFEFASGSKGMERRKPNRGK
FT                   QIDRSFSQRAVPGFRSQNEKVEHQGLSTDSDFENFLRNKRGNKAGVKSTASEGSSVDNI
FT                   SSREFQFARQNQAKEDGSSSEFAAQGGRKSKGISGRRKQTSSWKDRGNPGTDTGVHLRE
FT                   HSDPGNVRADGVSGPSGGSEINGGSISPRVLQPEGSGQLDQSFQDYLFGPEHQQNDIPS
FT                   GL"
FT   CDS             6784. .7365
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /label=ORF_3
FT                   /db_xref="GOA:P27737"
FT                   /db_xref="InterPro:IPR008879"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27737"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAA42589.1"
FT                   /translation="MAAVLNLQLKVDASLKAFLGAENRPLHGKTGATLEQILESIFANI
FT                   AIQGTSEQTEFLDLVVEVKSMEDQSVLGSYNLKEVVNLIKAFKTTSSDPNINKMTFRQV
FT                   CEAFAPEARNGLVKLKYKGVFTNLFTTMPEVGSKYPELMFDFNKGLNMFIMNKAQQKVI
FT                   TNMNRRLLQTEFAKSENEAKLSSVSTDLCI"
XX
SQ   Sequence 7555 BP; 2384 A; 1334 C; 1802 G; 2035 T; 0 other;

m58152 Length: 7555  14-NOV-2006  Type: N  Check: 2149  ..
       1  tgatactgat acagtgtaca ctcacgacgt gagtaaacag attgacgtaa
      51  cgcctcaatc gtggtcaagg accagcattt caatgctatc acattaaata
     101  caatcacgtt gtattacaaa actttccgtt taattacgtg aaaggttaca
     151  aatggccttc tcttacagaa cgccacagga ggaacttctg agcagactac
     201  cacagtccca acaggaggtg atcagcggat ttcagtacga acgcattcaa
     251  aaggaggaag agaagaaggt ggaaaacttc tctttttacc taccagagaa
     301  aaccagggag tggtttacta agtcaggtgt ctatctttcg cctttcgctt
     351  atgttaatca ttctcaccct ggttgtaaaa ctctggagaa ccacctttta
     401  tttaatgttg tagctagtta tattagtaag tactcctatg tagcttgtct
     451  tagtattaaa tctaataaaa tgagcaaaat ggaacgattg ggtcctaatt
     501  ctgttaaaac atatgatatt ttgaacagac tggtgaccgc taaggataaa
     551  gctcgctatg gccctttggc caaaccggag aggtctccat gcccaaagaa
     601  aactaacatt ttcattcatg atgagattca ctattggtca agggatcaac
     651  ttgagacttt cctccaagtc cacaggccaa agaatttgtg ggcaactttg
     701  gttttccctc cagagatact tgctggttac aaatcgtctg ttttaccatt
     751  cctttatcag tttgaaattc atgggaaaga cttggtttat atgcctgatg
     801  gagtaagatc tgaaagttac acacagcctc ttgagaatgg ttttttacta
     851  agctccagca gcataatcat caaaaacaga gtcacggggg ttgaaatcag
     901  gtaccaagtt agtcttgtat attctctggg gtctcaccat ctgtttcata
     951  tttacccagc tgaggatcta atgaaagaag aggttaggag atttgggcct
    1001  tacgaccttt ttgatgtggg ttcacttttt gtgaaaccag tgcgcgttcc
    1051  cattcaagat tttccactta gcgtatttaa gaaaatcttc atctacatga
    1101  gctcactaaa gaaacctgat gtacaatcag cagtggcaaa gttgaggcag
    1151  ttgtctgatg ccgacatttc catagaaagt gtgttcatga ttcaggagtt
    1201  tgcaagtagg atagagaaga acggtgtgga gagttggtcc tgctcattct
    1251  ggggatgcat gaaggattgg ttctttgaca agttaccata tagggaggtg
    1301  ttggaaaaaa tagggttggc tgatgatttc accaggaggt tgatgaagat
    1351  taaaccatta gcctttgaca ttcacacaac tgacaggcca ttgacagtca
    1401  gaatgattat agatcagatc tgggaagaga ggctgagctc attcgacaac
    1451  atttcaaata ttgtcttcta tgggagaaga gaatggctca acaatggagt
    1501  tttaccaaaa gtaaaaaaaa aaggtttggc caaattgatt cccggaaggg
    1551  aagttgattc acacaactac ccaagagaga tatattctga tttgctgtca
    1601  tccacgtcga tttggaggtc atatgatgat gacttcagac acaggagtgc
    1651  tagcccttta gtgatcttga ggtccaatag agcttactct gaagcagcaa
    1701  aattcagctc aaattgtctg agtttgtgtg cagcaccctg tgatgaagtc
    1751  attgcaagaa ccccttttga attgaatcac agaagagaga agaaggagct
    1801  atccctcaaa tgcctggatt ttcatatcaa gaaaatgaag gtgaaaaacg
    1851  tgctcgagct tgaggtcaag ctcagagaac gcaacaccag aatttctttg
    1901  agcaaaaagg gagttaagaa agcagggaga tcaaggatga ttccagtgca
    1951  tctgcttaaa ccaacctgcg gtgaaggaaa tggcaaacct gaagagagga
    2001  ataaggagga agcaaagatt ccaatgaatg aagggacaag caaagaagaa
    2051  aaggggtccg aacctccaca ttctgaagtt aaaagggaag gtgttagatt
    2101  ggatgagcaa cacatttcag aacccctttt gagttttaaa ttagacgact
    2151  tcgtcggaag ggagaaactt tgttctgctg gtttaatcaa aactgttgga
    2201  aacgattatc tcttgttagc cagacaaatt gaatgtatgc cactttctca
    2251  actcagagga aagaaagcag catacttctg tcttgacttt ccaatggtgt
    2301  attttcatga taaagtttct tacccaacat ttgaggcaac tggggaaatc
    2351  agacatgtca tgatgaaagc aagaagcaaa tgggggattg atttcaacag
    2401  cgcactaatt caagtttata atgatggatg caggttacct ttgcacagtg
    2451  ataatgagga gtgttatgac gatgacggga tcctcaccat taacgtcgtg
    2501  ggagatgcaa agtttcacac cacctgccat gatgaggtca tagatcttaa
    2551  acaagggaat gagatattga tgcctgcagg ttaccaaaag aaaaatagac
    2601  atgctgtgga ggtcgcttca gaaggaagga caagtgttac cctcagggtt
    2651  cacaaaaggg atttcagttt tgagtcaaag cttagattca tcaagggtaa
    2701  attcgactgc ctatttgtca gtgtggctga aataatacac aaaaaaccag
    2751  aggaaatcat gatgttcatc ccacacatta tggacaggtg tgtgagtaat
    2801  aggggttgct cacttgatga tgcaaaagca atatgtgaaa aatatgaaat
    2851  caaaatagag tgcgaaggcg attgcggctt ggttgagtgt gggacatcag
    2901  gtctttccat tggaaggatg ctgcttaggg gaaaccactt ttctgtcgct
    2951  tcagttagga ggtcatctat ggattcgctt gctaactcat caaaggagat
    3001  caagtcagat ggagtcttag atcacgtaac attcaacttc cacaaaagac
    3051  tcaaacttgt tgaacctgat ttgaccaatg cagacatcaa agtggattct
    3101  tcaagggcag gaaagctgct caaaagtctg atggatggca tgactggaat
    3151  tgtttctcac aattcaaccc atgaagggtg gaggatgatc aaagggataa
    3201  acagcacctc tgagatgaga tcgttcatga atatggtgag gggtcaaatt
    3251  gaagagccca aaagtgatct gtttgacaag gttcaagaac tgaactttat
    3301  gaaggtgaag atttatggca ttttcggatt tgctggatca ggaaaaagtc
    3351  atgcaattca gaatttaata caaactgaat tcaaaggttc acaagggatt
    3401  atggtgatct gccccagaag atttttggca aaagattgga gcgaaaaagg
    3451  agtggacgaa aaggacatta aaacttttga gagtgcatta aagtcagatg
    3501  tcaaaggaaa gagattattt atactggatg aaatcagttt gctccctaaa
    3551  ggtttcactg atcttttgat gcttaagatg catatggaag gaatccttaa
    3601  aaagtcaaca attgtttgta taggggaccc gctccaggct ggatactttt
    3651  gtcctaagga tgacaactac ttgtctaggg aaggagaaat taaacggctt
    3701  ttcaaaggag gggtaaacta caaatggtac agttacagaa ttaacaaatt
    3751  cattgcaaaa aaactggcca tagaaacaat gaatgacttc attggaatag
    3801  atgaacaaag ttcgatctac aaagatatgc cgtcagctca ccacttcatg
    3851  gaaaagaaag ggaatcatat agaggtcatc ttggttgcca gtatggtgga
    3901  aaaggaactt tactccaact atgggaatgt gatgacattt ggggagtcac
    3951  aaggtttaac attcaattgt ggagtaatag tactttccga ggaggccaag
    4001  ctgtgttccg atgcgcatat aatggttgca atcacaaggt tcagaagagg
    4051  cttctgcttt gcgttgggga gcaaagggtc aaaagaagat tatatgaggt
    4101  caatgaagag cggtctgctt caaagaatat gttcgggcgt tggtgcttca
    4151  aaagaattca ttttggggtc ctcctccgtc aacttgattt tgagtgagaa
    4201  agacatcgcc aaaggagcag ggattgatga gatggataga gaagctagac
    4251  tggaaggaga tgtctggctc aagagtatga tataccttgg aaaaagatat
    4301  cacatggttg aaccacttgg tcaagtgatt aagctaactg atgatgcaat
    4351  taaatgccac attccggttt gttcaagtca gacactaggt cctgagctcg
    4401  ataacatcca agcaagagaa tacagagaat ttaaaggaaa aaatgggtgg
    4451  tcgaatcagt tcagagaaga agctgggcca aattggaaat tcccttacaa
    4501  ggtcaatcaa gcgatgagtt atgaggctgt gtatcccaga cacaaaatgg
    4551  atgatgatct cactttcctt gctgccataa agaagaggct tcgctttgac
    4601  aacgttgcca acaattacgc aaaattcaag gcagcagaga gcagagggaa
    4651  gtatctgaca aaaatctttc tcaaacatgt gcccatcaaa tgtggcaggg
    4701  accaaaggct cctggatcaa tgcaggcaag aatttgagga gacgaaacta
    4751  tctaaaagtg cggccacaat tggagcacac tctcagaggt cagactcgga
    4801  ttggcccttg gataagattt tcctgttcat gaaatcgcaa ctttgcacaa
    4851  aattcgaaaa aagatttaca gaagctaagg caggccagac tttggcttgt
    4901  tttccacaca aaattctcgt ggaatttagc ccatggtgtc gatacacaga
    4951  aaaggtgctc actgcaaact taccggataa ttactacatt catcaaagga
    5001  aaaatttcag tgaattggag gattttgcca gaagattttc aaatggttca
    5051  atatgtgtgg aatcagatta tacagctttt gacgtttcac aagatcacac
    5101  cattttagca tttgaggtgg aattgctcag acattttggt tgggacgaca
    5151  gagtccttca gagttacatt aagatgaagt gtactttggg ttgcagactt
    5201  ggaggttttg ctataatgag gttcactggg gaattttcaa cctttctgtt
    5251  caatacgctt gcaaacatgg ttttcacatt ttgcagatac gaggttcctg
    5301  atggaacccc aatctgcttc gccggtgatg acatgtgcgc tctgagaaac
    5351  ttgagggaga ttgacaccca tgaattcatc ttgagcaagc tgagtttgaa
    5401  ggccaaggtt aacagaacaa aagtgccaat gttttgtgga tggcgattgt
    5451  gctgcgatgg tttgatcaaa gaaccttgct taatctatga aaggctgcag
    5501  gtggcaattg agaatgggag attgatggat gtgatagact catattttct
    5551  ggagttttca ttcgcctaca aattaggtga gaggctctat tcacatcttg
    5601  aaattgaaca actgaattat catcaggttt taacaagatt cttcataagg
    5651  aataaacatc tactcagagg ggattcaagg cataacattt ctgaacttga
    5701  gtggttgtct gacgaagatg gcgacaatga taaggggtca cagattgagg
    5751  atcgcagaag gggatattcc aattgctggg gtgaaaagct ccagaattta
    5801  ttctgacatt agccccttca aaaaggcgtc tgaccttatg atccattgga
    5851  atgaattcgt tttcaaggtc atgcctgaag acatagcagg ggatggtttc
    5901  agattggcgt cgatacctgt gataccctcg tctgaagtgc aagcagtttt
    5951  aaggaaaaga gaaagtacaa attatgtgca ctggggggca ctgtccatat
    6001  caattgatgc attgttcagg aagaatgcag gggtgtcagg ttggtgttac
    6051  gtttatgata acaggtggga gacatttgag caggccatgc tgcagaagtt
    6101  tcatttcaat ctggatagtg gttccgccac cttggtgact tcaccaaact
    6151  ttccagtttc actggatgac cctggcttgt caaactcaat tagtgtggca
    6201  gtgatgttcg agaacctcaa ctttaagttt gagagctacc caattagtgt
    6251  gagagttgga aatatgtgca ggttctttga tagcttcttg agcagtgtta
    6301  agaataaagt tgactcaaat tttttgcttg aagcttcgaa tgcagatccg
    6351  ctgggagtgg gtgcttttgg atttgagcaa gatgaccaag ttagtgaact
    6401  tttcaattac attcaaacgg tcccaactca agccatcaaa ttcagagagc
    6451  atgagatacc taaagggttt ttgggtatga tgggaaagaa aaagatcaaa
    6501  tcttttgagt ttgcctcagg ttcaaagggt atggagagaa ggaaaccaaa
    6551  tagaggaaag caaattgaca gatcattcag ccaaagggct gtccctggat
    6601  ttaggtccca gaatgagaag gttgaacatc aaggcttatc aacagacagc
    6651  gatttcgaga attttctcag aaacaagagg ggtaataaag ctggagttaa
    6701  atccactgct tcagaagggt catcagttga taacatttct tcaagagaat
    6751  ttcagtttgc tcgacagaac caggcgaagg aggatggcag cagttctgaa
    6801  tttgcagctc aaggtggacg caagtctaaa ggcatttctg ggcgcagaaa
    6851  acagacctct tcatggaaag acaggggcaa ccctggaaca gatactggag
    6901  tccatcttcg cgaacatagc gatccaggga acgtcagagc agacggagtt
    6951  tctggaccta gtggtggaag tgaaatcaat ggaggatcaa tcagtcctcg
    7001  ggtcttacaa cctgaaggaa gtggtcaact tgatcaaagc tttcaagact
    7051  acctcttcgg acccgaacat caacaaaatg acattccgtc aggtctgtga
    7101  agctttcgca ccagaggcaa gaaatggact ggtcaaattg aaatacaaag
    7151  gggtttttac aaacctcttt acaactatgc cggaagtggg gagcaagtac
    7201  ccggagctaa tgtttgattt caataagggt ctgaatatgt tcatcatgaa
    7251  caaggcccag cagaaagtta taaccaatat gaatcggcgt cttttacaga
    7301  ctgaattcgc aaagagcgag aacgaggcaa agctctcgtc tgtgtcgact
    7351  gatctttgca tttagtctgt tcaggaagtt tggttcaata aataaaataa
    7401  acaaatagtg tgttgtgtgc tcaagtgtgt ttactttaag catgtttacg
    7451  caaataaact cttgaaccca tgaaagagta taaagagtca tggtatttaa
    7501  ttggagtgtt tagacttata ataaatagcc tgtagacttt taaatatttt
    7551  actac