!!NA_SEQUENCE 1.0
ID   S71490     standard; genomic RNA; VRL; 633 BP.
XX
AC   S71490;
XX
SV   S71490.1
XX
DT   21-APR-1995 (Rel. 43, Created)
DT   01-SEP-2004 (Rel. 81, Last updated, Version 3)
XX
DE   CP=coat protein [beet necrotic yellow vein virus BNYVV, NM, Genomic RNA,
DE   633 nt].
XX
KW   .
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RC   GenBank staff at the National Library of Medicine created this entry [NCBI
RC   gibbsq 150503] from the original journal article.
RP   1-633
RX   MEDLINE; 94257821.
RX   PUBMED; 8199322.
RA   Yao H., Liu Y., Yu J., Cai Z., Ao G., Yang L.;
RT   "The cloning and sequencing of coat protein gene from beet necrotic yellow
RT   vein virus";
RL   Chin. J. Biotechnol. 9(2):131-135(1993).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .633
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /organism="Beet necrotic yellow vein virus"
FT   gene            51. .617
FT                   /note="CP"
FT                   /gene="CP"
FT   CDS             51. .617
FT                   /codon_start=1
FT                   /db_xref="GOA:Q86757"
FT                   /db_xref="UniProt/TrEMBL:Q86757"
FT                   /note="coat protein"
FT                   /gene="CP"
FT                   /product="CP"
FT                   /protein_id="AAB30891.1"
FT                   /translation="MSSEGRYMTWKDMSHNKFMTDRWARVSDVVSVIKQSHAMDLSKAA
FT                   NLSIIKTALAGLGSGWSDNNPFVSPTTRFPQTLTMYGALVLYVNLSDPEFALIMTKVNT
FT                   LTDSGLADNASANVRRDVVSGHKAESSGKTAGTNENSAYTLTVSLAGLAQALRLEELMW
FT                   TRDKFEDRFKLPWTPVQGRTSPPGQ"
XX
SQ   Sequence 633 BP; 175 A; 123 C; 153 G; 182 T; 0 other;

 S71490  Length: 633  September 7, 2004 08:32  Type: N  Check: 2908  ..
       1  tataggtgcg agtaataagt agccgccgtc cagaagaaga tagtactaac
      51  atgtcgagtg aaggtagata tatgacatgg aaggatatgt cacataataa
     101  gtttatgacc gatcgatggg cccgtgtttc ggacgtcgtg agtgttatta
     151  aacaatcgca tgctatggac ttgtccaagg ctgcgaatct atctataatt
     201  aaaactgctt tggcaggatt aggctcgggt tggtctgaca ataatccttt
     251  tgtatccccg acgacccgtt ttccacagac actaactatg tacggtgcac
     301  ttgtgttata tgttaatctg tctgacccag aatttgcgtt gataatgact
     351  aaggtaaata ctttaactga ttcagggtta gcagataacg catctgctaa
     401  tgtgcgtaga gatgtggtgt ccggacataa agccgaatca tccggtaaaa
     451  ctgctggcac taatgagaat tctgcttata cgcttaccgt tagtcttgct
     501  ggtttggctc aagctcttag gcttgaggaa ttaatgtgga ctcgggataa
     551  gtttgaggac cggtttaaat taccatggac acctgttcaa ggtagaacca
     601  gtccacccgg acaatagcaa ttagctgctg ctc