!!NA_SEQUENCE 1.0
ID   S80856     standard; genomic RNA; VRL; 1509 BP.
XX
AC   S80856;
XX
SV   S80856.1
XX
DT   27-MAY-1996 (Rel. 47, Created)
DT   01-SEP-2004 (Rel. 81, Last updated, Version 4)
XX
DE   Beet necrotic yellow vein virus 54 kDa protein gene, complete cds.
XX
KW   .
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RC   GenBank staff at the National Library of Medicine created this entry [NCBI
RC   gibbsq 175331] from the original journal article.
RP   1-1509
RX   MEDLINE; 96156375.
RX   PUBMED; 8562847.
RA   Yu J., Li D., Yang L., Liu Y.;
RT   "cDNA cloning and sequencing of 54kDa fragment of the 75kDa readthrough
RT   protein gene from beet necrotic yellow vein virus";
RL   Chin. J. Biotechnol. 11(2):119-123(1995).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1509
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /isolate="Inner Mongolia"
FT                   /segment="RNA2"
FT   CDS             1. .1509
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q86971"
FT                   /note="54 kDa fragment of the 75 kDa readthrough protein"
FT                   /product="54 kDa protein"
FT                   /protein_id="AAB36037.2"
FT                   /translation="MQLAAARVTAHIRAAKRALLYPGDSPEWVGWKHFYPPPPYDVYDV
FT                   PPLDIINAKLAADDIGGLVTPTPASSHGLPFEVSEEVEQANRNSLWLTVGLLLAALAVG
FT                   IGVAAYHRKKLQSRLRELKLLWSSTGGSGGGGGFDTELYTRATDTVSLGTTLSEHVASA
FT                   PSGLRHRPAATDSGPHEALPFEVWVFHNLAVVYDSIGMSDLFYTVREFVGVFNGEFEGL
FT                   IELLESPDDDDGVYTNAPRDTAIDAYESQENYDRIDIETVLLERRINLKKLLLEEAELE
FT                   RRERDMTMIADEEQRTLLHRLESSRVEATHAVAKAEADARAAVAMAALASKEANDYDSK
FT                   MAFDRSCKEQELRLRELEVNSMPSKTERYVHTGIQGGAQLAGAMAVGAMLRRGAGSSSQ
FT                   TVSSGANIGSRSQSSTRGRSASQPLSSVGGSTRGVNNNISDTNLVRAGNSAAVSAGRST
FT                   NSGNSNFWSKLRVGEGWSKYSVERAATRAQRAIVLPAPPSAPAG"
XX
SQ   Sequence 1509 BP; 363 A; 279 C; 424 G; 443 T; 0 other;

S80856  Length: 1509  September 7, 2004 08:32  Type: N  Check: 7861  ..
       1  atgcaattag ctgctgctcg ggtgacggca cacattcgag cggcgaagcg
      51  ggcactatta tatcctggtg atagtcccga gtgggttggt tggaaacatt
     101  tctatcctcc tccaccatat gatgtgtacg atgtgccacc gctggatatt
     151  attaacgcca aattggctgc tgatgatatc ggcggtcttg ttactcctac
     201  accggcatcc tcacatggtc ttccttttga agtttctgag gaagttgagc
     251  aggcaaatag gaatagtcta tggctaacag ttggactgct attagctgct
     301  ttggcagttg ggattggtgt agctgcttat cataggaaga agctccaaag
     351  tagattacgt gagttaaaat tgctatggag ctctactggt gggtctggtg
     401  gtggtggtgg ttttgacacc gagctgtata cgcgtgctac agatactgtt
     451  agtttgggaa ccactctttc agagcatgtt gcttcagctc cgtcaggatt
     501  acggcaccga cctgctgcta ctgatagtgg acctcatgaa gcactgccgt
     551  ttgaggtgtg ggtgtttcat aatctagccg tagtgtatga ttcgattggt
     601  atgagtgatt tattttatac tgttagagag tttgttgggg tgtttaacgg
     651  tgagtttgaa gggcttatag agctgttaga gtcacccgat gatgatgatg
     701  gtgtgtatac gaatgctcct agagacactg ctattgatgc ctatgaatct
     751  caagaaaact acgatcgtat tgatattgaa actgtcttgc tcgagaggcg
     801  tataaatttg aagaagttgc ttcttgaaga agcagagcta gaacgacgag
     851  agcgagatat gactatgatt gctgatgaag aacagagaac attgctacat
     901  aggttggaaa gttctagggt tgaagcaact catgcagttg ccaaagccga
     951  agctgatgct cgggcagctg ttgctatggc tgctcttgct tccaaggaag
    1001  ctaatgatta cgatagtaag atggcttttg acaggtcttg taaagaacag
    1051  gaactgcggt tgcgcgaact cgaagtgaat agtatgccga gtaaaacaga
    1101  gaggtatgtt cacactggta tacaaggtgg tgcgcaattg gctggagcta
    1151  tggctgttgg tgctatgctg cgacgtgggg ctggttcttc ttctcaaacc
    1201  gtttctagtg gtgctaatat tggttctcgt tcacagagtt cgactcgtgg
    1251  tcgtagtgca tcacaacctt tgtcatcggt tggtggttct actcgtgggg
    1301  ttaataataa tattagtgat actaatcttg ttagggctgg taatagtgct
    1351  gcagtttctg ctggtagatc tactaatagt ggtaatagta atttttggtc
    1401  taaattgcgt gttggtgaag gatggtccaa gtacagcgta gaacgggcgg
    1451  cgacaagggc gcaaagggca atcgtgcttc cagcgccccc gtccgctccc
    1501  gccggatga