ID   U25668; SV 1; linear; genomic RNA; STD; VRL; 633 BP.
XX
AC   U25668;
XX
DT   15-AUG-1995 (Rel. 44, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Beet necrotic yellow vein virus coat protein gene, complete cds.
XX
KW   .
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-633
RA   Yao H., Liu Y., Yu J., Cai Z., Ao G., Yang L.;
RT   "The cloning and sequencing of coat protein gene from beet necrotic yellow
RT   vein virus";
RL   Chin. J. Biotechnol. 9(No.2):147-151(1993).
XX
RN   [2]
RP   1-633
RA   Xu L.;
RT   ;
RL   Submitted (21-APR-1995) to the EMBL/GenBank/DDBJ databases.
RL   Lin Xu, Institute of Biophysics, Academia Sinica, Dept. of Protein
RL   Engineering, 15 Datun Road, Chaoyang District, Beijing 100101, Peoples
RL   Republic of China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .633
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:31721"
FT   CDS             51. .617
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /label=JC1065
FT                   /db_xref="GOA:Q65668"
FT                   /db_xref="InterPro:IPR001337"
FT                   /db_xref="UniProtKB/TrEMBL:Q65668"
FT                   /protein_id="AAA74193.1"
FT                   /translation="MSSEGRYMTWKDMSHNKFMTDRWARVSDVVSVIKQSHAMDLSKAA
FT                   NLSIIKTALAPLGSGWSDNNPFVSPTTRFPQTLTMYGALVLYVNLSDPEFALIMTKVNT
FT                   LTDSGLADNASANVRRDVVSGHKAESSGKTAGTNENSAYTLTVSLAGLAQALRLEELMW
FT                   TRDKFEDRFKLPWTPVQGRTSPPGQ"
XX
SQ   Sequence 633 BP; 175 A; 125 C; 151 G; 182 T; 0 other;

u25668 Length: 633  14-NOV-2006  Type: N  Check: 2544  ..
       1  tataggtgcg agtaataagt agccgccgtc cagaagaaga tagtactaac
      51  atgtcgagtg aaggtagata tatgacatgg aaggatatgt cacataataa
     101  gtttatgacc gatcgatggg cccgtgtttc ggacgtcgtg agtgttatta
     151  aacaatcgca tgctatggac ttgtccaagg ctgcgaatct atctataatt
     201  aaaactgctt tggcaccatt aggctcgggt tggtctgaca ataatccttt
     251  tgtatccccg acgacccgtt ttccacagac actaactatg tacggtgcac
     301  ttgtgttata tgttaatctg tctgacccag aatttgcgtt gataatgact
     351  aaggtaaata ctttaactga ttcagggtta gcagataacg catctgctaa
     401  tgtgcgtaga gatgtggtgt ccggacataa agccgaatca tccggtaaaa
     451  ctgctggcac taatgagaat tctgcttata cgcttaccgt tagtcttgct
     501  ggtttggctc aagctcttag gcttgaggaa ttaatgtgga ctcgggataa
     551  gtttgaggac cggtttaaat taccatggac acctgttcaa ggtagaacca
     601  gtccacccgg acaatagcaa ttagctgctg ctc