!!NA_SEQUENCE 1.0
ID   U78292     standard; RNA; VRL; 1348 BP.
XX
AC   U78292;
XX
SV   U78292.1
XX
DT   04-DEC-1997 (Rel. 53, Created)
DT   01-AUG-2001 (Rel. 68, Last updated, Version 2)
XX
DE   Beet necrotic yellow vein virus p26 gene, complete cds.
XX
KW   .
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-1348
RX   MEDLINE; 97412816.
RX   PUBMED; 9267459.
RA   Koenig R., Haeberle A.M., Commandeur U.;
RT   "Detection and characterization of a distinct type of beet necrotic yellow
RT   vein virus RNA 5 in a sugarbeet growing area in Europe";
RL   Arch. Virol. 142(7):1499-1504(1997).
XX
RN   [2]
RP   1-1348
RA   Koenig R.;
RT   ;
RL   Submitted (15-NOV-1996) to the EMBL/GenBank/DDBJ databases.
RL   Biologische Bundesanstalt fuer Land-und Forstwirtschaft, Institut Biochemie
RL   und Pflanzenvirologie, Messeweg 11, Braunschweig, D38104, Germany
XX
DR   SPTREMBL; O55494; O55494.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1348
FT                   /chromosome="RNA5"
FT                   /db_xref="taxon:31721"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /strain="F28"
FT                   /specific_host="Beta vulgaris"
FT   5'UTR           1. .436
FT   CDS             437. .1135
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:O55494"
FT                   /product="p26"
FT                   /protein_id="AAB87729.1"
FT                   /translation="MDIDHCMPVFDMAYSDDNHLPYYILRSTHNVVRDVDYTGFICYPL
FT                   QVDLNDNVEVGADIYHMKIKTMRLNVDIYNNDDVATNFPGWVRFIVFCTPPVSSWVNGG
FT                   CSSLFSPFVGVNSFIDPKLLKRDGHGITVLHDGIYCLRYQEFFTGSFELNFRGPGNYTL
FT                   TNNVCWSPATSVDSIYVACVASWCGDSAFMLQSDSVAWVHKRFWQRPVLEFGQCLDDLP
FT                   DHDNNNNDCG"
FT   3'UTR           1136. .1348
FT   polyA_site      1348
XX
SQ   Sequence 1348 BP; 353 A; 211 C; 300 G; 484 T; 0 other;

U78292  Length: 1348  December 21, 2001 16:00  Type: N  Check: 9491  ..
       1  aaattcaaag tactttcaca ttgtacttat tagtaccgct gttctaagtg
      51  acgtaagtgg agtgtaggcc cggggagctg gatgcagtaa tttatcgatg
     101  taccttttcg actacctcaa tttgaaaacg agtgtaaagt aaaagggagg
     151  ttactaaaca aaatagccct ccatacggta cgatttataa tcatatttat
     201  atgtccactt ggtgtcactc agaagcagtg tttgtgaaaa tttgtgcgtg
     251  agccttgtgc cgcacttgcg tgacctttgg ccgcttttcc tttgcgactg
     301  tactttgttt ttccgctcgc acaagcgtta ttgtactagt tacggtgcgt
     351  aaaaataaaa taaaataaac aaattgaatt attaacagta atttgcaatt
     401  tgcaagttgc gatcacaatt atatttacaa tttatgatgg atattgatca
     451  ttgtatgcct gtatttgata tggcatatag cgacgataat caccttcctt
     501  attacatatt gagatcgact cataatgtgg ttcgggatgt tgattatact
     551  ggttttatat gttatccttt gcaggtcgat cttaatgata atgttgaggt
     601  cggtgctgat atttatcaca tgaagattaa gactatgaga cttaatgtcg
     651  atatttataa caatgatgat gttgccacaa attttccagg ttgggttagg
     701  tttattgtgt tttgtacacc tcctgtgtct tcttgggtta atggcgggtg
     751  ctctagtctg ttttcacctt ttgtaggtgt gaatagtttt attgacccta
     801  aattgttaaa acgtgatggt catgggatta ctgtgttaca tgatggtatt
     851  tattgtttgc gctatcaaga attttttacc ggaagttttg agctcaactt
     901  tcgtggacct ggtaattata ccctaactaa taatgtttgt tggtcccccg
     951  ctactagtgt ggattctata tatgtggctt gtgttgctag ttggtgtggt
    1001  gatagtgctt ttatgttgca gtccgatagt gtggcttggg tacacaagag
    1051  attttggcaa cgacctgtgt tggaatttgg gcaatgttta gatgatctac
    1101  cagatcatga taataataat aatgattgtg gatgatcgtt tgtgacgtcc
    1151  gaagacgtta aactacccgc atatgcggtg tttacgggct cgtttacaag
    1201  cctccttgct atggtaaggt ttatgtaaac acaaaaatat ggcttattgg
    1251  ttatgctaaa cctcatatgt tattaaataa ggttgagatg tactgactgg
    1301  atgtgaaatg tgccagtctt catagggttc tctgtcagtg tattgaca