!!NA_SEQUENCE 1.0
ID   U78293     standard; RNA; VRL; 1349 BP.
XX
AC   U78293;
XX
SV   U78293.1
XX
DT   04-DEC-1997 (Rel. 53, Created)
DT   01-AUG-2001 (Rel. 68, Last updated, Version 2)
XX
DE   Beet necrotic yellow vein virus p26 gene, complete cds.
XX
KW   .
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-1349
RX   MEDLINE; 97412816.
RX   PUBMED; 9267459.
RA   Koenig R., Haeberle A.M., Commandeur U.;
RT   "Detection and characterization of a distinct type of beet necrotic yellow
RT   vein virus RNA 5 in a sugarbeet growing area in Europe";
RL   Arch. Virol. 142(7):1499-1504(1997).
XX
RN   [2]
RP   1-1349
RA   Koenig R.;
RT   ;
RL   Submitted (15-NOV-1996) to the EMBL/GenBank/DDBJ databases.
RL   Biologische Bundesanstalt fuer Land-und Forstwirtschaft, Institut Biochemie
RL   und Pflanzenvirologie, Messeweg 11, Braunschweig, D38104, Germany
XX
DR   SPTREMBL; O55495; O55495.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1349
FT                   /chromosome="RNA5"
FT                   /db_xref="taxon:31721"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /strain="F72"
FT                   /specific_host="Beta vulgaris"
FT   5'UTR           1. .437
FT   CDS             438. .1136
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:O55495"
FT                   /product="p26"
FT                   /protein_id="AAB87730.1"
FT                   /translation="MDIDHCMPVFDMAYSDDNHLPYYIQRSTHNAVRDVDYTGFICYPL
FT                   QVDLNDNVEVGADIYHMKIKTMRLNVDIYNNDDVATNFPGWVRFIVFCTPPVSSWVNGG
FT                   CSSLFSPFVGVNSFIDPKLLKRDGHGITVLHDGIYCLRYQEFFTGSFEFNFRGPGNYTL
FT                   TNDVCWSPATSVDSIYVACVASWCGDSAFMLQSDSVAWVHKRFWQRPVLEFGQCLDDLP
FT                   DHDNNNNDCG"
FT   3'UTR           1137. .1349
FT   polyA_site      1349
XX
SQ   Sequence 1349 BP; 353 A; 214 C; 302 G; 480 T; 0 other;

U78293  Length: 1349  December 21, 2001 16:00  Type: N  Check: 6929  ..
       1  aaattcaaag tactttcaca ttgtacttat tagtaccgct gttctaagtg
      51  acgtaagtgg agtgtaggcc cggggagctg gatgcagtaa tttatcgatg
     101  taccttttcg actacctcaa tttgaaaacg agtgtaaagt aaaagggagg
     151  ttactaaaca aaaatagccc tccatacggt acgatttata atcatattta
     201  tatgtccact tggtgtcact cagaagcagt gtttgtgaaa atttgtgcgt
     251  gagccttgtg ccgcacttgc gtgacctttg gccgcttttc ctttgcgact
     301  gtactttgtt tttccgctcg cacaagcgtt attgtactag ttacggtgcg
     351  taaaaataaa ataaaataaa caaattgaat tattaacagt aatttgcaat
     401  ttgcaagttg cgatcacaat tatatttaca acttgtgatg gatattgatc
     451  attgtatgcc tgtatttgat atggcatata gcgacgataa tcaccttcct
     501  tattacatac agagatcgac tcataatgcg gttcgggatg ttgattatac
     551  tggttttata tgttatcctt tgcaggtcga tcttaatgat aatgttgagg
     601  tcggtgctga tatttatcac atgaagatta agactatgag acttaatgtc
     651  gatatttata acaatgatga tgttgccaca aattttccag gttgggttag
     701  gtttattgtg ttttgtacac ctcctgtgtc ttcttgggtt aatggcgggt
     751  gctctagtct gttttcacct tttgtaggtg tgaatagttt tattgaccct
     801  aaattgttaa aacgtgatgg tcatgggatt actgtgttac atgatggtat
     851  ttactgtttg cgctatcaag aattttttac cggaagtttt gagttcaact
     901  ttcgtggacc tggtaattat accctaacta atgatgtttg ttggtccccc
     951  gctactagtg tggattctat atatgtggct tgtgttgcta gttggtgtgg
    1001  tgatagtgct tttatgttgc agtccgatag tgtggcttgg gtacacaaga
    1051  gattttggca acgacctgtg ttggaatttg ggcaatgttt agatgatcta
    1101  ccagatcatg ataataataa taatgattgt ggatgatcgt ttgtgacgtc
    1151  cgaagacgtt aaactacccg catatgcggt gtttacgggc tcgtttacaa
    1201  gcctccttgc tatggtaagg tttatgtaaa cacaaaaata tggcttattg
    1251  gttatgctaa acctcatatg ttattaaata aggttgagat gtactgactg
    1301  gatgtgaaat gtgccagtct tcatagggtt ctctgtcagt gtattgaca