!!NA_SEQUENCE 1.0
ID   COCPMVB    standard; RNA; VRL; 5889 BP.
XX
AC   X00206;
XX
SV   X00206.1
XX
DT   20-FEB-1985 (Rel. 05, Created)
DT   12-SEP-1993 (Rel. 36, Last updated, Version 2)
XX
DE   Cowpea mosaic virus bottom component RNA (B RNA)
XX
KW   complementary DNA; polyprotein; protease.
XX
OS   Cowpea mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Comoviridae;
OC   Comovirus.
XX
RN   [1]
RP   1-5889
RA   Lomonossoff G.P., Shanks M.;
RT   "The nucleotide sequence of cowpea mosaic virus B RNA";
RL   EMBO J. 2:2253-2258(1983).
XX
DR   SWISS-PROT; P03600; VGNB_CPMV.
XX
CC   Data kindly reviewed (23-JUL-1985) by G. Lomonossoff
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5889
FT                   /db_xref="taxon:12264"
FT                   /organism="Cowpea mosaic virus"
FT   misc_feature    1. .206
FT                   /note="5' leader sequence"
FT   CDS             207. .5807
FT                   /db_xref="SWISS-PROT:P03600"
FT                   /note="B RNA polyprotein"
FT                   /protein_id="CAA25029.1"
FT                   /translation="MGLPEYEADSEALLSQLTIEFTPGMTVSSLLAQVTTNDFHSAIEF
FT                   FAAEKAVDIEGVHYNAYMQQIRKNPSLLRISVVAYAFHVSDMVAETMSYDVYEFLYKHY
FT                   ALFISNLVTRTLRFKELLLFCKQQFLEKMQASIVWAPELEQYLQVEGDAVAQGVSQLLY
FT                   KMVTWVPTFVRGAVDWSVDAILVSFRKHFEKMVQEYVPMAHRVCSWLSQLWDKIVQWIS
FT                   QASETMGWFLDGCRDLMTWGIATLATCSALSLVEKLLVAMGFLVEPFGLSGIFLRTGVV
FT                   AAACYNYGTNSKGFAEMMALLSLAANCVSTVIVGGFFPGEKDNAQSSPVILLEGLAGQM
FT                   QNFCETTLVSVGKTCTAVNAISTCCGNLKALAGRILGMLRDFIWKTLGFETRFLADASL
FT                   LFGEDVDGWLKAISDLRDQFIAKSYCSQDEMMQILVLLEKGRQMRKSGLSKGGISPAII
FT                   NLILKGINDLEQLNRSCSVQGVRGVRKMPFTIFFQGKSRTGKSLLMSQVTKDFQDHYGL
FT                   GGETVYSRNPCDQYWSGYRRQPFVLMDDFAAVVTEPSAEAQMINLISSAPYPLNMAGLE
FT                   EKGICFDSQFVFVSTNFLEVSPEAKVRDDEAFKNRRHVIVQVSNDPAKAYDAANFASNQ
FT                   IYTILAWKDGRYNTVCVIEDYDELVAYLLTRSQQHAEEQEKNLANMMKSATFESHFKSL
FT                   VEVLELGSMISAGFDIIRPEKLPSEAKEKRVLYSIPYNGEYCNALIDDNYNVTCWFGEC
FT                   VGNPEQLSKYSEKMLLGAYEFLLCSESLNVVIQAHLKEMVCPHHYDKELNFIGKIGETY
FT                   YHNQMVSNIGSMQKWHRAILFGIGVLLGKEKEKTWYQVQVANVKQALYDMYTKEIRDWP
FT                   MPIKVTCGIVLAAIGGSAFWKVFQQLVGSGNGPVLMGVAAGAFSAEPQSRKPNRFDMQQ
FT                   YRYNNVPLKRRVWADAQMSLDQSSVAIMSKCRANLVFGGTNLQIVMVPGRRFLACKHFF
FT                   THIKTKLRVEIVMDGRRYYHQFDPANIYDIPDSELVLYSHPSLEDVSHSCWDLFCWDPD
FT                   KELPSVFGADFLSCKYNKFGGFYEAQYADIKVRTKKECLTIQSGNYVNKVSRYLEYEAP
FT                   TIPEDCGSLVIAHIGGKHKIVGVHVAGIQGKIGCASLLPPLEPIAQAQGAEEYFDFLPA
FT                   EENVSSGVAMVAGLKQGVYIPLPTKTALVETPSEWHLDTPCDKVPSILVPTDPRIPAQH
FT                   EGYDPAKSGVSKYSQPMSALDPELLGEVANDVLELWHDCAVDWDDFGEVSLEEALNGCE
FT                   GVEYMERIPLATSEGFPHILSRNGKEKGKRRFVQGDDCVVSLIPGTTVAKAYEELEASA
FT                   HRFVPALVGIECPKDEKLPMRKVFDKPKTRCFTILPMEYNLVVRRKFLNFVRFIMANRH
FT                   RLSCQVGINPYSMEWSRLAARMKEKGNDVLCCDYSSFDGLLSKQVMDVIASMINELCGG
FT                   EDQLKNARRNLLMACCSRLAICKNTVWRVECGIPSGFPMTVIVNSIFNEILIRYHYKKL
FT                   MREQQAPELMVQSFDKLIGLVTYGDDNLISVNAVVTPYFDGKKLKQSLAQGGVTITDGK
FT                   DKTSLELPFRRLEECDFLKRTFVQRSSTIWDAPEDKASLWSQLHYVNCNNCEKEVAYLT
FT                   NVVNVLRELYMHSPREATEFRRKVLKKVSWITSGDLPTLAQLQEFYEYQRQQGGADNND
FT                   TCDLLTSVDLLGPPLSFEKEAMHGCKVSEEIVTKNLAYYDFKRKGEDEVVFLFNTLYPQ
FT                   SSLPDGCHSVTWSQGSGRGGLPTQSWMSYNISRKDSNINKIIRTAVSSKKRVIFCARDN
FT                   MVPVNIVALLCAVRNKLMPTAVSNATLVKVMENAKAFKFLPEEFNFAFSDV"
XX
SQ   Sequence 5889 BP; 1598 A; 1030 C; 1461 G; 1800 T; 0 other;

X00206  Length: 5889  December 21, 2001 16:00  Type: N  Check: 5765  ..
       1  tattaaaatc aatacaggtt ttgataaaag cgaacgtgga gaaatccaaa
      51  cctttctttc tttcctcaat ctcttcaatt gcgaacgaaa tccaagcttt
     101  ggttttgctg aaacaaatac acaacgtata ctgaatttgg caaatttctc
     151  tctctctctc tgtcattttc tttcttctgt cgggactttc ttagtcttga
     201  cccaacatgg gtctcccaga atatgaggcc gatagtgagg ctttattaag
     251  tcaactcact atcgaattca cacccggcat gacagtttct tcattgttgg
     301  cacaagtcac cactaatgac tttcacagtg ccattgagtt ttttgctgca
     351  gaaaaagcag tagacattga gggcgttcat tacaatgcgt atatgcaaca
     401  aattaggaaa aaccctagtt tattacgcat ttccgtggta gcttatgctt
     451  tccacgtttc agacatggta gctgagacca tgtcttatga tgtttatgaa
     501  tttctgtata aacattatgc ccttttcatc tctaatctgg tgaccagaac
     551  actcagattt aaagagcttt tgctgttctg taagcagcaa tttctggaga
     601  aaatgcaagc ttcaatagtc tgggctccgg aacttgagca atatcttcaa
     651  gttgaagggg atgctgtggc tcaaggagtt tcacaactgt tatacaagat
     701  ggtcacttgg gtgcccactt ttgtcagagg agcagtagac tggagcgttg
     751  atgcgatttt ggtcagtttc aggaaacatt ttgaaaagat ggttcaggag
     801  tatgtgccca tggctcatcg cgtttgcagt tggctgagcc aactatggga
     851  taagatcgtg caatggatct cacaagcaag tgagaccatg ggttggtttc
     901  tagatggttg tcgggatttg atgacttggg gaattgccac tctcgcaaca
     951  tgtagtgctc tctccctggt tgagaagctg ttagtcgcaa tgggttttct
    1001  ggttgagcct ttcggcttga gtggaatctt cttgcggacg ggagttgttg
    1051  cggcagcttg ttataactat gggactaatt ctaagggttt tgccgagatg
    1101  atggctttgt tgtcattggc ggctaactgt gtctctacag ttatagttgg
    1151  tggctttttc cctggtgaaa aggacaatgc acagagtagt cctgttatcc
    1201  tcttagaagg attggctggg cagatgcaaa acttttgtga gactacactt
    1251  gtcagtgttg ggaaaacatg cactgccgtc aatgctatct caacatgttg
    1301  tgggaatctg aaagcactgg ccggaaggat cttgggcatg ctcagagatt
    1351  ttatctggaa gactttgggc tttgagacca gatttctagc agatgcatct
    1401  ttgctttttg gcgaggatgt tgatggatgg ctcaaagcaa tcagtgatct
    1451  gcgagatcaa tttattgcca aatcatactg ttcgcaggat gagatgatgc
    1501  agattttggt gttgcttgaa aagggaaggc agatgcggaa aagtggtctt
    1551  tctaaaggag gcatttctcc tgctatcatt aatctgattc tcaaagggat
    1601  taatgatctt gaacaattga accgcagctg ttcagtgcaa ggagtaagag
    1651  gagttaggaa aatgccattt accattttct tccaaggaaa gtcacgcact
    1701  ggtaagagtt tgctgatgag tcaggttaca aaggattttc aggatcacta
    1751  tggattgggt ggagaaactg tgtacagtag aaatccttgt gatcaatatt
    1801  ggagtggata tcggcggcaa ccttttgtgc tgatggatga ttttgccgcc
    1851  gttgttactg agccgtctgc tgaggctcag atgatcaatc tgatttctag
    1901  tgctccatat cctttgaata tggctggact tgaagaaaaa ggaatttgtt
    1951  ttgattctca atttgttttt gtttccacca acttcttgga agtatctcct
    2001  gaagccaaag ttagggacga tgaggctttc aagaacagga gacatgtgat
    2051  tgttcaggtt tcaaatgatc ctgccaaagc atatgatgct gcaaattttg
    2101  ctagcaacca aatttacacc attttggcat ggaaggatgg tcgatacaac
    2151  accgtgtgcg ttattgagga ctatgatgag ctggtggcat atttgttgac
    2201  taggagtcaa cagcatgctg aagagcagga gaagaatctt gctaacatga
    2251  tgaagagtgc tacatttgaa agtcatttca aaagtttagt tgaagtcctt
    2301  gagctcggtt ctatgatatc tgctggtttt gatatcattc ggccagaaaa
    2351  acttcctagt gaagctaagg agaagagagt cctttacagt attccctaca
    2401  atggggagta ttgtaatgca ctcattgatg acaattacaa tgttacttgc
    2451  tggtttggtg agtgtgttgg taatcctgag cagctctcta agtacagtga
    2501  aaagatgctt ttgggtgctt atgaatttct tctgtgttct gagagcttga
    2551  atgttgtaat tcaggcacat ttgaaggaaa tggtttgccc tcaccattat
    2601  gacaaggagc tcaattttat tggcaagata ggagagacct actatcacaa
    2651  tcagatggtt tcaaatatcg gctctatgca gaaatggcat cgtgccattc
    2701  tgtttggaat tggggttctc ttgggaaagg aaaaagagaa gacatggtac
    2751  caagttcagg ttgccaatgt taaacaagct ctttacgaca tgtacactaa
    2801  ggagattcgt gattggccca tgccgatcaa agtcacctgt ggaattgtct
    2851  tggcagctat tgggggtagt gccttttgga aagtgtttca acaactagtg
    2901  ggaagcggaa atggtccagt attgatgggt gtggctgctg gagcattcag
    2951  tgctgagcct caaagtagaa agcccaatag gtttgatatg cagcaataca
    3001  ggtacaacaa tgttcctctc aagagaagag tttgggcaga cgcacaaatg
    3051  tctttggatc agagtagtgt tgctatcatg tctaagtgta gggctaatct
    3101  ggtttttgga ggcactaatt tgcaaatagt catggtacca ggaagacgct
    3151  ttttggcatg caaacatttc ttcacccaca taaagaccaa attgcgtgtg
    3201  gaaatagtta tggatggaag aaggtactat catcaatttg atcctgcaaa
    3251  tatttatgat atacctgatt ctgagttggt cttgtactcc catcctagct
    3301  tggaagacgt ttcccattct tgctgggatc tgttctgttg ggacccagac
    3351  aaagaattgc cttcagtatt tggagcggat ttcttgagtt gtaaatacaa
    3401  caagtttggg ggtttttatg aggcgcaata tgctgatatc aaagtgcgca
    3451  caaagaaaga atgccttacc atacagagtg gtaattatgt gaacaaggtg
    3501  tctcgctatc ttgagtatga agctcctact atccctgagg attgtggatc
    3551  tcttgtgata gcacacattg gtgggaagca caagattgtg ggtgttcatg
    3601  ttgctggtat tcaaggtaag ataggatgtg cttccttatt gccaccattg
    3651  gagccaatag cacaagcgca aggtgctgag gaatactttg attttcttcc
    3701  agctgaagag aatgtatctt ctggagtggc tatggtagca ggactcaaac
    3751  aaggagttta cataccatta cccacaaaaa cagcgctagt ggagaccccc
    3801  tccgagtggc atttggacac accatgtgac aaagttccta gcattttagt
    3851  tcccacggat ccccgaattc ctgcgcaaca tgaaggatat gatcctgcta
    3901  agagtggggt ttccaagtat tcccagccta tgtctgctct ggaccctgag
    3951  ttacttggcg aggtggctaa tgatgttctc gagctatggc atgactgcgc
    4001  tgtagattgg gacgattttg gtgaagtgtc tctggaggaa gctttgaatg
    4051  gatgtgaagg agtggaatat atggaaagga ttccattagc aacttctgag
    4101  ggctttccgc acattctttc tagaaatggg aaagaaaagg ggaaaagacg
    4151  gtttgttcag ggagatgatt gtgttgtctc actaattcca ggaactactg
    4201  tagccaaagc ttatgaggag ttggaagcaa gtgcacacag atttgttccc
    4251  gctcttgttg ggattgaatg tccaaaagat gagaagttgc ctatgagaaa
    4301  ggtttttgat aagcctaaga ccaggtgttt taccattttg ccaatggaat
    4351  ataatttggt cgttcgtagg aagtttctga attttgtgcg ctttatcatg
    4401  gccaatcgtc acagactcag ttgtcaagtg ggtattaatc catattcaat
    4451  ggaatggagt cgcttagcag caaggatgaa agagaaaggc aatgatgtct
    4501  tgtgttgtga ttatagctca ttcgatggct tgctttctaa gcaagtgatg
    4551  gatgtcattg ctagcatgat caatgaactt tgtggtggag aggatcaact
    4601  caaaaatgca aggcgaaact tgttaatggc gtgttgctct aggttggcta
    4651  tttgcaagaa tacagtatgg agagttgagt gtggtattcc ttcagggttt
    4701  ccaatgacag tgattgtgaa tagcattttt aatgagattc tcattcgcta
    4751  tcattacaag aaactcatgc gcgaacaaca agctcctgaa ctgatggtac
    4801  agagttttga taaactcata gggctggtga cttatggtga tgataatctg
    4851  atttcagtga atgctgttgt gacaccctat tttgatggga agaaattgaa
    4901  gcaatctttg gctcagggtg gtgtgactat cactgatggt aaggacaaaa
    4951  caagtttgga acttcctttt cgcagattgg aagaatgtga ttttctcaag
    5001  agaacttttg ttcagaggag cagtaccatc tgggacgctc cagaggataa
    5051  ggcaagtttg tggtcgcagc ttcattatgt taattgcaac aattgtgaga
    5101  aagaagttgc ttatttgact aatgttgtta atgttcttcg tgaactttat
    5151  atgcatagtc ctcgggaagc cacagaattt aggaggaagg tcttaaagaa
    5201  ggtcagttgg atcactagtg gagatttgcc tactttggca caattgcaag
    5251  agttctatga gtaccagcgg cagcaaggtg gggcagacaa caatgacact
    5301  tgtgacttgt taacaagtgt agacttgcta ggtcctcctt tgtcttttga
    5351  gaaagaagcg atgcacggat gcaaagtgtc tgaagaaatc gtcaccaaga
    5401  atttggcata ttacgatttc aaaaggaaag gtgaggatga agtggtattt
    5451  ctgttcaata cgctctatcc tcagagttca ttgcctgatg ggtgtcactc
    5501  tgtgacctgg tctcagggta gtggaagggg aggtttgccc acacaaagtt
    5551  ggatgagcta taatataagc aggaaagatt ctaatatcaa caagattatt
    5601  agaactgctg tttcttcgaa gaaacgagtg atattctgtg ctcgtgataa
    5651  tatggttcct gttaacattg tagctttgct ctgtgctgtt agaaacaagc
    5701  tgatgcccac tgctgtatct aatgctacac ttgtcaaggt gatggaaaat
    5751  gccaaagctt tcaagttttt accagaagag ttcaatttcg ctttttctga
    5801  tgtttaggta aataatgctt atgtttttgt ttgctcctgt ttagcaggtc
    5851  gttccttcag caagaacaac aaaaatatgt gtttttatt