!!NA_SEQUENCE 1.0
ID   COCPMVM    standard; genomic RNA; VRL; 3481 BP.
XX
AC   X00729;
XX
SV   X00729.1
XX
DT   20-FEB-1985 (Rel. 05, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 6)
XX
DE   Cowpea mosaic virus (CPMV) middle-component RNA (M RNA)
XX
KW   capsid protein; polyprotein.
XX
OS   Cowpea mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Comoviridae;
OC   Comovirus.
XX
RN   [1]
RP   1-3481
RX   MEDLINE; 84057775.
RX   PUBMED; 6641721.
RA   van Wezenbeek P.M.G.F., Verver J., Harmsen J., Vos P., van Kammen A.;
RT   "Primary structure and gene organization of the middle-component RNA of
RT   cowpea mosaic virus";
RL   EMBO J. 2(6):941-946(1983).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3481
FT                   /db_xref="taxon:12264"
FT                   /mol_type="genomic RNA"
FT                   /organism="Cowpea mosaic virus"
FT   CDS             <114. .224
FT                   /db_xref="UniProt/TrEMBL:Q66169"
FT                   /note="ORF1"
FT                   /product="hypothetical protein"
FT                   /protein_id="CAA25316.1"
FT                   /translation="HERSSTLSDRASAPVQCFLSLKRNQRSLCGHVVRRH"
FT   CDS             161. .3301
FT                   /db_xref="GOA:P03599"
FT                   /db_xref="HSSP:1BMV"
FT                   /db_xref="InterPro:IPR003181"
FT                   /db_xref="InterPro:IPR003182"
FT                   /db_xref="InterPro:IPR008975"
FT                   /db_xref="UniProt/Swiss-Prot:P03599"
FT                   /note="precursor polypeptide"
FT                   /protein_id="CAA25314.1"
FT                   /translation="MFSFTEAKSKISLWTRSAAPLNNVYLSYSCRCGLGKRKLAGGCCS
FT                   APYITCYDSADFRRVQYLYFCLTRYCCLYFFLLLLADWFYKKSSIFFETEFSRGFRTWR
FT                   KIVKLLYILPKFEMESIMSRGIPSGILEEKAIQFKRAKEGNKPLKDEIPKPEDMYVSHT
FT                   SKWNVLRKMSQKTVDLSKAAAGMGFINKHMLTGNILAQPTTVLDIPVTKDKTLAMASDF
FT                   IRKENLKTSAIHIGAIEIIIQSFASPESDLMGGFLLVDSLHTDTANAIRSIFVAPMRGG
FT                   RPVRVVTFPNTLAPVSCDLNNRFKLICSLPNCDIVQGSQVAEVSVNVAGCATSIEKSHT
FT                   PSQLYTEEFEKEGAVVVEYLGRQTYCAQPSNLPTEEKLRSLKFDFHVEQPSVLKLSNSC
FT                   NAHFVKGESLKYSISGKEAENHAVHATVVSREGASAAPKQYDPILGRVLDPRNGNVAFP
FT                   QMEQNLFALSLDDTSSVRGSLLDTKFAQTRVLLSKAMAGGDVLLDEYLYDVVNGQDFRA
FT                   TVAFLRTHVITGKIKVTATTNISDNSGCCLMLAINSGVRGKYSTDVYTICSQDSMTWNP
FT                   GCKKNFSFTFNPNPCGDSWSAEMISRSRVRMTVICVSGWTLSPTTDVIAKLDWSIVNEK
FT                   CEPTIYHLADCQNWLPLNRWMGKLTFPQGVTSEVRRMPLSIGGGAGATQAFLANMPNSW
FT                   ISMWRYFRGELHFEVTKMSSPYIKATVTFLIAFGNLSDAFGFYESFPHRIVQFAEVEEK
FT                   CTLVFSQQEFVTAWSTQVNPRTTLEADGCPYLYAIIHDSTTGTISGDFNLGVKLVGIKD
FT                   FCGIGSNPGIDGSRLLGAIAQGPVCAEASDVYSPCMIASTPPAPFSDVTAVTFDLINGK
FT                   ITPVGDDNWNTHIYNPPIMNVLRTAAWKSGTIHVQLNVRGAGVKRADWDGQVFVYLRQS
FT                   MNPESYDARTFVISQPGSAMLNFSFDIIGPNSGFEFAESPWANQTTWYLECVATNPRQI
FT                   QQFEVNMRFDPNFRVAGNILMPPFPLSTETPPLLKFRFRDIERSKRSVMVGHTATAA"
FT   CDS             512. .3301
FT                   /db_xref="GOA:Q66170"
FT                   /db_xref="HSSP:1BMV"
FT                   /db_xref="InterPro:IPR003181"
FT                   /db_xref="InterPro:IPR003182"
FT                   /db_xref="UniProt/TrEMBL:Q66170"
FT                   /note="poss. precursor polypeptide"
FT                   /protein_id="CAA25315.1"
FT                   /translation="MESIMSRGIPSGILEEKAIQFKRAKEGNKPLKDEIPKPEDMYVSH
FT                   TSKWNVLRKMSQKTVDLSKAAAGMGFINKHMLTGNILAQPTTVLDIPVTKDKTLAMASD
FT                   FIRKENLKTSAIHIGAIEIIIQSFASPESDLMGGFLLVDSLHTDTANAIRSIFVAPMRG
FT                   GRPVRVVTFPNTLAPVSCDLNNRFKLICSLPNCDIVQGSQVAEVSVNVAGCATSIEKSH
FT                   TPSQLYTEEFEKEGAVVVEYLGRQTYCAQPSNLPTEEKLRSLKFDFHVEQPSVLKLSNS
FT                   CNAHFVKGESLKYSISGKEAENHAVHATVVSREGASAAPKQYDPILGRVLDPRNGNVAF
FT                   PQMEQNLFALSLDDTSSVRGSLLDTKFAQTRVLLSKAMAGGDVLLDEYLYDVVNGQDFR
FT                   ATVAFLRTHVITGKIKVTATTNISDNSGCCLMLAINSGVRGKYSTDVYTICSQDSMTWN
FT                   PGCKKNFSFTFNPNPCGDSWSAEMISRSRVRMTVICVSGWTLSPTTDVIAKLDWSIVNE
FT                   KCEPTIYHLADCQNWLPLNRWMGKLTFPQGVTSEVRRMPLSIGGGAGATQAFLANMPNS
FT                   WISMWRYFRGELHFEVTKMSSPYIKATVTFLIAFGNLSDAFGFYESFPHRIVQFAEVEE
FT                   KCTLVFSQQEFVTAWSTQVNPRTTLEADGCPYLYAIIHDSTTGTISGDFNLGVKLVGIK
FT                   DFCGIGSNPGIDGSRLLGAIAQGPVCAEASDVYSPCMIASTPPAPFSDVTAVTFDLING
FT                   KITPVGDDNWNTHIYNPPIMNVLRTAAWKSGTIHVQLNVRGAGVKRADWDGQVFVYLRQ
FT                   SMNPESYDARTFVISQPGSAMLNFSFDIIGPNSGFEFAESPWANQTTWYLECVATNPRQ
FT                   IQQFEVNMRFDPNFRVAGNILMPPFPLSTETPPLLKFRFRDIERSKRSVMVGHTATAA"
FT   CDS             524. .3301
FT                   /db_xref="GOA:Q9WJE1"
FT                   /db_xref="HSSP:1BMV"
FT                   /db_xref="InterPro:IPR003181"
FT                   /db_xref="InterPro:IPR003182"
FT                   /db_xref="UniProt/TrEMBL:Q9WJE1"
FT                   /note="poss. precursor polypeptide"
FT                   /protein_id="CAA25317.1"
FT                   /translation="MSRGIPSGILEEKAIQFKRAKEGNKPLKDEIPKPEDMYVSHTSKW
FT                   NVLRKMSQKTVDLSKAAAGMGFINKHMLTGNILAQPTTVLDIPVTKDKTLAMASDFIRK
FT                   ENLKTSAIHIGAIEIIIQSFASPESDLMGGFLLVDSLHTDTANAIRSIFVAPMRGGRPV
FT                   RVVTFPNTLAPVSCDLNNRFKLICSLPNCDIVQGSQVAEVSVNVAGCATSIEKSHTPSQ
FT                   LYTEEFEKEGAVVVEYLGRQTYCAQPSNLPTEEKLRSLKFDFHVEQPSVLKLSNSCNAH
FT                   FVKGESLKYSISGKEAENHAVHATVVSREGASAAPKQYDPILGRVLDPRNGNVAFPQME
FT                   QNLFALSLDDTSSVRGSLLDTKFAQTRVLLSKAMAGGDVLLDEYLYDVVNGQDFRATVA
FT                   FLRTHVITGKIKVTATTNISDNSGCCLMLAINSGVRGKYSTDVYTICSQDSMTWNPGCK
FT                   KNFSFTFNPNPCGDSWSAEMISRSRVRMTVICVSGWTLSPTTDVIAKLDWSIVNEKCEP
FT                   TIYHLADCQNWLPLNRWMGKLTFPQGVTSEVRRMPLSIGGGAGATQAFLANMPNSWISM
FT                   WRYFRGELHFEVTKMSSPYIKATVTFLIAFGNLSDAFGFYESFPHRIVQFAEVEEKCTL
FT                   VFSQQEFVTAWSTQVNPRTTLEADGCPYLYAIIHDSTTGTISGDFNLGVKLVGIKDFCG
FT                   IGSNPGIDGSRLLGAIAQGPVCAEASDVYSPCMIASTPPAPFSDVTAVTFDLINGKITP
FT                   VGDDNWNTHIYNPPIMNVLRTAAWKSGTIHVQLNVRGAGVKRADWDGQVFVYLRQSMNP
FT                   ESYDARTFVISQPGSAMLNFSFDIIGPNSGFEFAESPWANQTTWYLECVATNPRQIQQF
FT                   EVNMRFDPNFRVAGNILMPPFPLSTETPPLLKFRFRDIERSKRSVMVGHTATAA"
FT   mat_peptide     1538. .2662
FT                   /note="VP 37"
FT   mat_peptide     2660. .3298
FT                   /note="VP 23"
FT   polyA_site      3481
FT                   /note="polyadenylation site"
XX
SQ   Sequence 3481 BP; 911 A; 692 C; 773 G; 1105 T; 0 other;

   X00729  Length: 3481  May 10, 2005 10:09  Type: N  Check: 7824  ..
       1  tattaaaatc ttaataggtt ttgataaaag cgaacgtggg gaaacccgaa
      51  ccaaaccttc ttctaaattc tctctcatct ctcttaaagc aaacttctct
     101  cttgtctttc ttgcatgagc gatcttcaac gttgtcagat cgtgcttcgg
     151  caccagtaca atgttttctt tcactgaagc gaaatcaaag atctctttgt
     201  ggacacgtag tgcggcgcca ttaaataacg tgtacttgtc ctattcttgt
     251  cggtgtggtc ttgggaaaag aaagcttgct ggaggctgct gttcagcccc
     301  atacattact tgttacgatt ctgctgactt tcggcgggtg caatatctct
     351  acttctgctt gacgaggtat tgttgcctgt acttctttct tcttcttctt
     401  gctgattggt tctataagaa atctagtatt ttctttgaaa cagagttttc
     451  ccgtggtttt cgaacttgga gaaagattgt taagcttctg tatattctgc
     501  ccaaatttga aatggaaagc attatgagcc gtggtattcc ttcaggaatt
     551  ttggaggaaa aagctattca gttcaaacgt gccaaagaag ggaataaacc
     601  cttgaaggat gagattccca agcctgagga tatgtatgtg tctcacactt
     651  ctaaatggaa tgtgctcaga aaaatgagcc aaaagactgt ggatctttcc
     701  aaagcagctg ctgggatggg attcatcaat aagcatatgc ttacgggcaa
     751  catcttggca caaccaacaa cagtcttgga tattcccgtc acaaaggata
     801  aaacacttgc gatggccagt gattttattc gtaaggagaa tctcaagact
     851  tctgccattc acattggagc aattgagatt attatccaga gctttgcttc
     901  ccctgaaagt gatttgatgg gaggcttttt gcttgtggat tctttacaca
     951  ctgatacagc taatgctatt cgtagcattt ttgttgctcc aatgcgggga
    1001  ggaagaccag tcagagtggt gaccttccca aatacactgg cacctgtatc
    1051  atgtgatctg aacaatagat tcaagctcat ttgctcattg ccaaactgtg
    1101  atattgtcca gggtagccaa gtagcagaag tgagtgtaaa tgttgcagga
    1151  tgtgctactt ccatagagaa atctcacacc ccttcccaat tgtatacaga
    1201  ggaatttgaa aaggagggtg ctgttgttgt agaatactta ggcagacaga
    1251  cctattgtgc tcagcctagc aatttaccca cagaagaaaa acttcggtcc
    1301  cttaagtttg actttcatgt tgaacaacca agtgtcctga agttatccaa
    1351  ttcctgcaat gcgcactttg tcaagggaga aagtttgaaa tactctattt
    1401  ctggcaaaga agcagaaaac catgcagttc atgctactgt ggtctctcga
    1451  gaaggggctt ctgcggcacc caagcaatat gatcctattt tgggacgggt
    1501  gctggatcca cgaaatggga atgtggcttt tccacaaatg gagcaaaact
    1551  tgtttgccct ttctttggat gatacaagct cagttcgtgg ttctttgctt
    1601  gacacaaaat tcgcacaaac tcgagttttg ttgtccaagg ctatggctgg
    1651  tggtgatgtg ttattggatg agtatctcta tgatgtggtc aatggacaag
    1701  attttagagc tactgtcgct tttttgcgca cccatgttat aacaggcaaa
    1751  ataaaggtga cagctaccac caacatttct gacaactcgg gttgttgttt
    1801  gatgttggcc ataaatagtg gtgtgagggg taagtatagt actgatgttt
    1851  atactatctg ctctcaagac tccatgacgt ggaacccagg gtgcaaaaag
    1901  aacttctcgt tcacatttaa tccaaaccct tgtggggatt cttggtctgc
    1951  tgagatgata agtcgaagca gagttaggat gacagttatt tgtgtttcgg
    2001  gatggacctt atctcctacc acagatgtga ttgccaagct agactggtca
    2051  attgtcaatg agaaatgtga gcccaccatt taccacttgg ctgattgtca
    2101  gaattggtta ccccttaatc gttggatggg aaaattgact tttccccagg
    2151  gtgtgacaag tgaggttcga aggatgcctc tttctatagg aggcggtgct
    2201  ggtgcgactc aagctttctt ggccaatatg cccaattcat ggatatcaat
    2251  gtggagatat tttagaggtg aacttcactt tgaagttact aaaatgagct
    2301  ctccatatat taaagccact gttacatttc tcatagcttt tggtaatctt
    2351  agtgatgcct ttggttttta tgagagtttt cctcatagaa ttgttcaatt
    2401  tgctgaggtt gaggaaaaat gtactttggt tttctcccaa caagagtttg
    2451  tcactgcttg gtcaacacaa gtaaacccca gaaccacact tgaagcagat
    2501  ggttgtccct acctatatgc aattattcat gatagtacaa caggtacaat
    2551  ctccggagat tttaatcttg gggtcaagct tgttggcatt aaggattttt
    2601  gtggtatagg ttctaatccg ggtattgatg gttcccgctt gcttggagct
    2651  atagcacaag gacctgtttg tgctgaagcc tcagatgtgt atagcccatg
    2701  tatgatagct agcactcctc ctgctccatt ttcagacgtt acagcagtaa
    2751  cttttgactt aatcaacggc aaaataactc ctgttggtga tgacaattgg
    2801  aatacgcaca tttataatcc tccaattatg aatgtcttgc gtactgctgc
    2851  ttggaaatct ggaactattc atgttcaact taatgttagg ggtgctggtg
    2901  tcaaaagagc agattgggat ggtcaagtct ttgtttacct gcgccagtcc
    2951  atgaaccctg aaagttatga tgcgcggaca tttgtgatct cacaacctgg
    3001  ttctgccatg ttgaacttct cttttgatat catagggccg aatagcggat
    3051  ttgaatttgc cgaaagccca tgggccaatc agaccacctg gtatcttgaa
    3101  tgtgttgcta ccaatcccag acaaatacag caatttgagg tcaacatgcg
    3151  cttcgatcct aatttcaggg ttgccggcaa tatcctgatg cccccatttc
    3201  cactgtcaac ggaaactcca ccgttattaa agtttaggtt tcgggatatt
    3251  gaacgctcca agcgtagtgt tatggttgga cacactgcta ctgctgctta
    3301  actctggttt cattaaattt tctttagttt gaatttactg ttatttggtg
    3351  tgcatttcta tgtttggtga gcggttttct gtgctcagag tgtgtttatt
    3401  ttatgtaatt taatttcttt gtgagctcct gtttagcagg tcgtcccttc
    3451  agcaaggaca caaaaagatt ttaattttat t