ID   X04197; SV 1; linear; genomic RNA; STD; VRL; 4612 BP.
XX
AC   X04197;
XX
DT   19-SEP-1987 (Rel. 13, Created)
DT   23-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Beet necrotic yellow vein virus RNA-2
XX
KW   coat protein; subgenome; unidentified reading frame.
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-4612
RA   Bouzoubaa S., Ziegler V., Beck D., Guilley H., Richards K., Jonard G.;
RT   "Nucleotide sequence of Beet Necrotic Yellow Vein Virus RNA-2";
RL   J. Gen. Virol. 67:1689-1700(1986).
XX
CC   Partial readthrough of the termination codon at position 709-711
CC   gives rise to 75K protein
CC   
CC   Data kindly reviewed (02-SEP-1987) by Bouzoubaa S.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4612
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /strain="isolate F13"
FT                   /mol_type="genomic RNA"
FT                   /clone="pBF14, pBC2"
FT                   /db_xref="taxon:31721"
FT   repeat_region   1. .8
FT                   /note="inverted repeat A"
FT   repeat_region   27. .34
FT                   /note="inverted repeat A'"
FT   CDS             145. .2220
FT                   /transl_except=(pos:709. .711,aa:OTHER)
FT                   /note="75K protein (aa 1-691)"
FT                   /note="read-through stop-codon"
FT                   /db_xref="GOA:Q9IR85"
FT                   /db_xref="InterPro:IPR001337"
FT                   /db_xref="UniProtKB/TrEMBL:Q9IR85"
FT                   /protein_id="CAB43511.1"
FT                   /translation="MSSEGRYMTWKDMSHNKFMTDRWARVSDVVSVIKQSHAMDLSKAA
FT                   NLSIIKTALAGLGSGWSDSNPFVSPMTRFPQTLTMYGALVLYVNLSDPEFALIMTKVNT
FT                   LTDSGLADNASANVRRDVVSGNKAESSGKTAGTNENSAYTLTVSLAGLAQALRLEELMW
FT                   TRDKFEDRFKLPWTPVQGRTSPPGQXQLAAARVTAHIRAAKRALLYPGDSPEWVGWKHF
FT                   YPPPPYDVYDVPPLDIINAKLAADDIGGLVTPTPASSHGLPFEVSEEVEQANRNSLWLT
FT                   VGLLLAALAIGIGVTAYHRKKLQSRLRELKLLWGSTGGSGGGGGFGTELHTRATDTVSL
FT                   GTTLSEHVAPAPSGLRHRPAATDSGPHEVLPFEVWVFDNLAVVYDSIGMSDLFYTVREF
FT                   VGVFNGEFEGLIELLESPDDDDGVYTNAPRDTAIDAYESQENYDRIDVETVLIERRINL
FT                   KKLLLEEAELERRERDMTMIADEEQRTLLHRLESSRVEATHVVTKAEADARAAVAMAAL
FT                   ASKEANDYDSKMAFDRSCKEQELRLRELEVNSMPSKTERYVHTGIQGGAQLAGAMAVGA
FT                   MLRRGASSSSQNVSGGANIGSRSQSLTRGRSASQPLSSVGGSTRGVNNNNISNTNLVRA
FT                   GNSAAVSAGRSTNSGNSNFWSKLRVGEGWSKYSVERAATRAQRAIVPPAPPSAPAG"
FT   CDS             145. .711
FT                   /note="coat protein; 21K (aa 1-188)"
FT                   /db_xref="GOA:Q88620"
FT                   /db_xref="InterPro:IPR001337"
FT                   /db_xref="UniProtKB/TrEMBL:Q88620"
FT                   /protein_id="CAA27791.1"
FT                   /translation="MSSEGRYMTWKDMSHNKFMTDRWARVSDVVSVIKQSHAMDLSKAA
FT                   NLSIIKTALAGLGSGWSDSNPFVSPMTRFPQTLTMYGALVLYVNLSDPEFALIMTKVNT
FT                   LTDSGLADNASANVRRDVVSGNKAESSGKTAGTNENSAYTLTVSLAGLAQALRLEELMW
FT                   TRDKFEDRFKLPWTPVQGRTSPPGQ"
FT   CDS             <712. .2220
FT                   /note="pot. 54K protein (aa 1-503)"
FT                   /db_xref="UniProtKB/TrEMBL:Q88621"
FT                   /protein_id="CAA27792.1"
FT                   /translation="QLAAARVTAHIRAAKRALLYPGDSPEWVGWKHFYPPPPYDVYDVP
FT                   PLDIINAKLAADDIGGLVTPTPASSHGLPFEVSEEVEQANRNSLWLTVGLLLAALAIGI
FT                   GVTAYHRKKLQSRLRELKLLWGSTGGSGGGGGFGTELHTRATDTVSLGTTLSEHVAPAP
FT                   SGLRHRPAATDSGPHEVLPFEVWVFDNLAVVYDSIGMSDLFYTVREFVGVFNGEFEGLI
FT                   ELLESPDDDDGVYTNAPRDTAIDAYESQENYDRIDVETVLIERRINLKKLLLEEAELER
FT                   RERDMTMIADEEQRTLLHRLESSRVEATHVVTKAEADARAAVAMAALASKEANDYDSKM
FT                   AFDRSCKEQELRLRELEVNSMPSKTERYVHTGIQGGAQLAGAMAVGAMLRRGASSSSQN
FT                   VSGGANIGSRSQSLTRGRSASQPLSSVGGSTRGVNNNNISNTNLVRAGNSAAVSAGRST
FT                   NSGNSNFWSKLRVGEGWSKYSVERAATRAQRAIVPPAPPSAPAG"
FT   CDS             2133. .3287
FT                   /note="42K protein (aa 1-384)"
FT                   /db_xref="GOA:Q89659"
FT                   /db_xref="InterPro:IPR000606"
FT                   /db_xref="UniProtKB/TrEMBL:Q89659"
FT                   /protein_id="CAA27793.1"
FT                   /translation="MVQVQRRTGGDKGAKGNRASSAPVRSRRMTQDDWSRTHPDDIFSV
FT                   IEKTLVEDGYKWNGVKPGHCDWGKLKESGAIDNFRGTLEGELGKNCDLTCNAAAVKLDT
FT                   LQKVKTSSDWTARVGIVLGAPGVGKSTSIKNLLDKFGAKHKMVLCLPFSQLLEGVFAGR
FT                   LDTFLVDDLFCRSVEYGKYNTMLVDEVTRVHMCEILVLAGHLGVKNVICFGDPAQGLNY
FT                   KAGSAVNYNFPIIAECYASRRFGKATADLINSSNGGGKPVVGNNEVKDSWTFEELCGKI
FT                   LDMSTVLVATRETQKFLLEDNIESILYSDAHGQTYDVVTIILEDEFDDAAICDPNVRAV
FT                   LLTRARKGGMIKMGPNIAARFKNGDFNSRGVSKSCTGDTFCEDR"
FT   CDS             3287. .3643
FT                   /note="pot. 13K protein (aa 1-117)"
FT                   /db_xref="InterPro:IPR001896"
FT                   /db_xref="UniProtKB/TrEMBL:Q88622"
FT                   /protein_id="CAA27794.1"
FT                   /translation="MSREITARPNKNVPIVVGVCVVAFFVLLAFMQQKHKTHSGGDYGV
FT                   PTFSNGGIYRDGTRSADFNSNNHRAYGCGGSGGSVSSRVGQQLIVLAIVSVLIVSLLQR
FT                   LRSPPEHICNGACG"
FT   CDS             3627. .4025
FT                   /note="pot. 15K protein (aa 1-132)"
FT                   /db_xref="InterPro:IPR002223"
FT                   /db_xref="InterPro:IPR010470"
FT                   /db_xref="UniProtKB/TrEMBL:Q89500"
FT                   /protein_id="CAA27795.1"
FT                   /translation="MVLVVKVDLSNIVLYIVAGCVVVSMLYSPFFSNDVKASSYAGAIF
FT                   KGSGCIMDRNSFAQFGSCDIPKHVAESITKVATKEHDVDIMVKRGEVTVRVVTLTETIF
FT                   IILSRLFGLAVFLFMICLMSIVWFWYHR"
FT   CDS             4043. .4426
FT                   /note="pot. 14K protein (aa 1-127)"
FT                   /db_xref="InterPro:IPR009884"
FT                   /db_xref="UniProtKB/TrEMBL:Q88623"
FT                   /protein_id="CAA27796.1"
FT                   /translation="MGMVDSLCVFVGRVITEGSESVEGVERFSIKFSEWKLFTIAVFVE
FT                   YRELGEKECSLKDAGRLHFNVSCVKCCQKLKCKKQNKNHSKHVQNGYLRKVRNFSILGV
FT                   CGDCCESFTLADEKPHVIVDPEV"
FT   polyA_site      4612. .4612
XX
SQ   Sequence 4612 BP; 1200 A; 760 C; 1209 G; 1443 T; 0 other;

x04197 Length: 4612  23-OCT-2008  Type: N  Check: 9958  ..
       1  aaattctaac tattatctcc attgaataga atttcaccgt ctgtcggttc
      51  ttattttgtt ctgggggcaa ttttattcag ggccctactt taaatatagg
     101  tgcgagtaat aagtagccgc cgtccagaag aagatagtac caacatgtcg
     151  agtgaaggta gatatatgac atggaaggat atgtcacata ataagtttat
     201  gaccgatcga tgggctcgtg tttcggacgt cgtgagtgtt attaaacaat
     251  cgcatgctat ggacttgtcc aaggctgcga atctatctat aattaaaact
     301  gctttggcag gattaggctc gggttggtct gacagtaatc cttttgtgtc
     351  tccgatgacc cgttttccac agacactaac tatgtatggt gcacttgtgt
     401  tatatgttaa tctgtctgac ccagaatttg cgttgataat gactaaggta
     451  aatactttaa ctgattcagg gttagcagat aatgcatctg ctaatgtacg
     501  tagagatgtg gtgtctggaa ataaagctga atcatccggt aaaactgctg
     551  gtactaatga gaactctgct tatacgctta ctgtcagtct tgctggttta
     601  gctcaagctc ttaggcttga agaattaatg tggacccggg ataaatttga
     651  ggaccggttc aaattaccat ggacacctgt tcaaggtaga accagtccac
     701  ccggacaata gcaattagct gctgctcggg tgacggcaca cattcgagcg
     751  gcgaagcggg cactattata tcctggtgat agtcccgagt gggttggttg
     801  gaaacatttc tatcctcctc caccatatga cgtgtatgat gtgccaccgc
     851  tggatattat taatgccaaa ttggctgctg atgatattgg cggtcttgtt
     901  actcccacac cggcatcctc acatggtctt ccttttgaag tttctgagga
     951  agttgagcag gcaaatagaa atagcctatg gctaacagtt ggattactat
    1001  tagctgcttt ggcaattggt attggtgtta ctgcttatca taggaagaag
    1051  ctccaaagta gattacgtga gttaaaatta ctatggggct ctactggtgg
    1101  gtctggtggt ggtggtggtt tcggcactga gctgcacacg cgtgctacag
    1151  ataccgttag tttgggaacc actctttcag agcatgttgc tccagctccg
    1201  tcaggattgc ggcaccgacc tgccgctact gatagcggac ctcacgaagt
    1251  actgccgttt gaggtgtggg tgtttgataa tctagccgta gtgtatgatt
    1301  cgattggtat gagtgattta ttttacactg ttagagagtt tgttggggtg
    1351  tttaacggtg agtttgaagg gcttatagag ctgttagagt cacctgatga
    1401  tgatgatggt gtgtatacaa atgctcctag agacactgct attgatgcct
    1451  acgaatctca agaaaattac gatcgtattg atgttgagac tgttttgatt
    1501  gagaggcgga taaacttgaa aaagttgctc cttgaagaag cagagctaga
    1551  acgacgagag cgagatatga ctatgattgc tgatgaagaa caaagaacat
    1601  tattgcatag gctggaaagt tctagggtcg aagcaactca tgtagttacc
    1651  aaagctgaag ctgatgctcg ggcggctgtg gctatggctg ctcttgcgtc
    1701  taaggaagct aatgactatg atagcaagat ggcttttgac aggtcctgta
    1751  aagaacagga attacggttg cgcgaacttg aagtgaatag tatgccgagt
    1801  aaaacagaaa ggtatgttca tactggtata caaggtggtg cgcaattggc
    1851  tggagctatg gctgttggtg ctatgctgcg acgtggggct agttcttctt
    1901  ctcaaaatgt ctctggtggt gctaatattg gttctcgttc gcagagtttg
    1951  actcgtggtc gtagtgcatc acaacctttg tcatcggttg gtggttctac
    2001  tcgtggggtt aataataata atattagtaa tactaatctt gttagggctg
    2051  gtaatagtgc tgcagtttct gctggtagat ctactaatag tggtaatagt
    2101  aatttttggt ccaaattgcg tgttggtgaa ggatggtcca agtacagcgt
    2151  agaacgggcg gcgacaaggg cgcaaagggc aatcgtgcct ccagcgcccc
    2201  cgtccgctcc cgccggatga ctcaggatga ctggtcacgt acccatcccg
    2251  acgatatttt ctcagttatt gagaaaacac tagtagagga tgggtataaa
    2301  tggaacgggg taaaacccgg acattgcgat tggggcaaat tgaaggaatc
    2351  tggtgctatt gataatttta ggggtacatt agaaggcgag ttaggtaaaa
    2401  attgtgattt aacttgtaat gctgctgccg tcaaactcga tacattgcaa
    2451  aaggtgaaaa cgtcatcaga ttggactgcc agagttggta ttgttttggg
    2501  tgctcctggt gttgggaaat ctacctcgat taaaaactta ttagacaaat
    2551  ttggagcaaa acataaaatg gtgttgtgct taccttttag tcagttgtta
    2601  gaaggggtat ttgctggtcg gttggacact tttctggttg acgatttgtt
    2651  ctgtaggtcc gtggaatacg gaaaatataa caccatgctt gtggatgagg
    2701  tcactcgtgt gcatatgtgt gagattttgg tgcttgccgg acatttaggt
    2751  gttaagaacg tgatatgttt tggtgatccg gcgcaagggt tgaattataa
    2801  ggccggttct gccgtgaact ataattttcc aattattgct gaatgttatg
    2851  ctagtaggcg gttcggtaaa gcgactgccg atctcatcaa ttccagcaat
    2901  ggtggtggta aacctgtagt tggtaataac gaagtaaagg atagttggac
    2951  ttttgaagaa ctatgtggga agatattgga tatgtctact gttttggtag
    3001  caacccgtga aacccaaaag tttctattag aagataatat tgagtctatt
    3051  ctttactcgg acgctcacgg gcaaacatat gacgttgtca ctatcatttt
    3101  ggaagacgag tttgatgatg ctgccatttg tgacccgaat gttagggctg
    3151  tcttgttaac tagagctcgt aagggtggta tgatcaagat gggtcctaac
    3201  attgctgcca ggttcaaaaa cggtgatttt aattcacgtg gagttagtaa
    3251  gtcttgtacc ggagatactt tttgcgaaga tagataatgt ctagggaaat
    3301  aaccgctcga cccaataaga atgtgcctat tgttgttggt gtttgtgttg
    3351  tggctttctt tgtattgctg gcgttcatgc agcaaaaaca taagacacat
    3401  tctgggggtg attacggagt cccaacattt tctaacggtg gtatatatag
    3451  agacggtaca agatcagctg attttaatag taacaatcat cgtgcttacg
    3501  ggtgcggtgg gtctgggggt agcgttagta gtcgagttgg gcagcaactt
    3551  attgtgttag ctattgtttc tgtgttaata gtgtcactat tacaacgatt
    3601  aaggtctcca ccagaacaca tttgtaatgg tgcttgtggt taaagtagat
    3651  ttatctaata ttgtattgta catagttgcc ggttgtgttg ttgtcagtat
    3701  gttgtactca ccgtttttca gcaacgatgt taaagcgtcc agctatgcgg
    3751  gagcaatttt taaggggagc ggctgtatca tggacaggaa ttcgtttgct
    3801  caatttggga gttgcgatat tccaaagcat gtagccgagt ccatcactaa
    3851  ggttgccacc aaagagcacg atgttgacat aatggtaaaa aggggtgaag
    3901  tgaccgttcg tgttgtgact ctcaccgaaa ctatttttat aatattatct
    3951  agattgtttg gtttggcggt gtttttgttc atgatatgtt taatgtctat
    4001  agtttggttt tggtatcata gataaattgt ggtagaacga gtatggggat
    4051  ggtagatagt ttgtgcgtgt ttgttggtcg agtcataact gagggatctg
    4101  aaagtgttga gggtgtggaa aggttttcca ttaagtttag tgagtggaaa
    4151  ttgttcacca tcgcggtgtt tgttgaatat cgtgagttag gtgagaaaga
    4201  gtgcagtttg aaggatgctg gtagattaca ctttaatgtg tcatgtgtga
    4251  aatgctgtca aaaacttaaa tgcaagaaac aaaataaaaa tcatagtaaa
    4301  cacgtccaaa atggatattt acgcaaggta cgtaattttt ccattttagg
    4351  tgtttgcggt gattgttgtg agtcttttac actcgcggac gaaaaacctc
    4401  atgttattgt cgatcctgag gtgtaacagg gtttattcaa gagactgtgt
    4451  ttaatattaa taatcagggc catgccacag gcctcctatt gggttgttcc
    4501  gaaggttgtt gtggtttata ttgcttattg atgagtgatt tgattaaggt
    4551  tgcagtgtac tgactgggtg tgaattgtac cagtccatgt agggtctgtt
    4601  ttcagtatat tg