!!NA_SEQUENCE 1.0
ID   NCBNYVV1   standard; RNA; VRL; 6746 BP.
XX
AC   X05147; D00115;
XX
SV   X05147.1
XX
DT   29-NOV-1987 (Rel. 14, Created)
DT   18-APR-1998 (Rel. 55, Last updated, Version 4)
XX
DE   Beet Necrotic Yellow Vein Virus complete RNA-1 with 237K ORF
XX
KW   subgenome; unidentified reading frame.
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-6746
RA   Bouzoubaa S., Quillet L., Guilley H., Jonard G., Richards K.;
RT   "Nucleotide sequence of beet necrotic yellow vein virus RNA-1";
RL   J. Gen. Virol. 68:615-626(1987).
XX
DR   SPTREMBL; Q83743; Q83743.
XX
CC   Data kindly reviewed (21-DEC-1987) by RICHARDS K.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .6746
FT                   /db_xref="taxon:31721"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /strain="isolate F2(for clone pBF5), isolate F13(other
FT                   cl.)"
FT                   /clone="pBF5"
FT   CDS             154. .6483
FT                   /db_xref="SPTREMBL:Q83743"
FT                   /note="(AA 1-2109)"
FT                   /product="237K ORF"
FT                   /protein_id="CAA28795.1"
FT                   /translation="MADSFGFTPMEVLLFGGESVQLLTSDMPIDVQWGFVYSTRCYALW
FT                   KDDLIHLNPLLKYSQRIAKRWEKLVSGFVGPVPLDKLLSLLAKLMRYCVNMGVSVQEIY
FT                   LSDAIVSSSYMLHVSRSAGCVSFSWLYAKLSMFASCGKFWVGSSHHTAANMIEGSRAVN
FT                   GPDVAISEMVEAFHLEVKSSLVVTVSLTPREKKILEREPGFVPLYKQKSRAPRNHPVLA
FT                   ALREVMRQEYSASCNILNTKLKTLVVGAASREVNCYSSNPSVHYYFANKDSKDLVRTTL
FT                   ELLHSALATKYRNMESGERELMNNLKGCGYIVKRSVENAIYEVVSDKDVAEVLRYAQTV
FT                   ASTKKEAKRKPNTGKRKMVMSEATRRTIELHELSRIVAEEKKIPNHFHFDESDFASVGN
FT                   FTQLVCEDVGYNFSVDAWLHLFEVTGAQTAVGYMALPNELLFEHYPISDYYDYWEGVEK
FT                   HGSLGGITISPLRNGQVVGMPTGVFQPVHFDKTSAGLGIPGSKMGTAERVICHMSDGLG
FT                   NGYNHVKSDWQTLLKHPILSSSKYNFAVEVDLTGRYGCLATFRLTRVTGVKYVARTIKL
FT                   RPEDRYVRVLDLLHIVRSIRLKGHAGLKEPYQYFPVYKREVDTTVSYCFSIAEKSLTVQ
FT                   NIANFIRHHIGGVSLVNKELVSAWRLNPQLVPSFAYAVYFYVVNLRGELDGMLQKLMKK
FT                   GITWADRLKANVSAFLRDMVDPISFLWTWLFERRLVDQIFQDGTDVFYQMDRACVDEKA
FT                   LRLNDHIKITRDFLPADTLLPEGWSLDDWEKAPDSLKTLSAAASLPVECGAVNCVGKSF
FT                   KSVRTLLPPSVVTSPVEQFFKSGGKFRDDAEFAELLSAHYRWQMDNSFCACQVCAALTG
FT                   KTGSQVVECRWKDESMYTFSMSQTEVDDFRNEIKAQSIEKGNRFGELLIGVHQKIPTQA
FT                   FEVSVRLEYVKGGPGTGKSFLIRSLADPIRDLVVAPFIKLRSDYQNQRVGDELLSWDFH
FT                   TPHKALDVTGKQIIFVDEFTAYDWRLLAVLAYRNHAHTIYLVGDEQQTGIQEGRGEGIS
FT                   ILNKIDLSKVSTHVPIMNFRNPVHDVKVLNYLFGSRMVPMSSVEKGFSFGDIKEFSSLS
FT                   NIPDTKIIHYSDETGEHMMPDYVRGVSKTTVRANQGSTYDNVVLPVLPSDLKLINSAEL
FT                   NLVALSRHRNKLTILLDNDGMNIGAVLKGMLEGVPEELERRDYIVGMYLGLHLPIKKEF
FT                   FFPESEFAKSFRLMVAKYEAFVPYDSDLPTLVSQGDVVVLDIARVENDINDAFDCADFY
FT                   NLVSRPNNCLVVAISECLGVTLEKLDNLMQANAVTLDKYHAWLSKKSPSTWQDCRMFAD
FT                   ALKVSMYVKVLSDKPYDLTYEVDGAGSSVTLYLTGKESDGHFIAAPLSSSLSTNERESG
FT                   DNSKKPADDSDTFDAANLFADKGVSSADMEAFCAYLEKTLMATIMKYDLSLQSWANVVD
FT                   DTDDFYQINISEFRQSTCFGKLLSALEVLKVDVSRKRFISDWLCKNLENKQFRWRWSSS
FT                   VASASSAGSNVDDDFVNMAGGKTDANADPADVLRQSFMDYASEFVPILIAESPIFMPLV
FT                   EPEPILSKCMVPEFDAFLLIKEFDLDNGADEYQCAYLNESVANRIGDKFVSGVLDTDII
FT                   SPLNLRGHPIAENVKYHSMCVAPAQIYFKRNQWQELQVQQARYLFRKVRNSPSSTQDSV
FT                   ARMVAQLFVSDCLVPNVADTFSASNLWRIMDKAMHDMVAKNYQGQMEEEFTRNAKLYRF
FT                   QLKDIEKPLKDPETDLAKAGQGILAWSKEAHVKFMVAFRVLNDLLLKSLNSNVVYDNTM
FT                   SETEFVGKINAAMNTVPDSAINGVIDAAACDSGQGVFTQLIERHIYAALGISDFFLDWY
FT                   FSFREKYVMQSRYVRAHMSYVKTSGEPGTLLGNTILMGAMLNAMLRGTGPFCMAMKGDD
FT                   GFKRQANLKINDQMLKLIKKETVLDFKLDLNVPITFCGYALSNGHLFPSVSRKLTKIAA
FT                   HRFREYKHFCEYQESLRDWIKNLPKDPAVYADFLECNASLSCRNVDDVQRWLDAIISVS
FT                   RIGREQFMMMFPIREVFMSLPPVEDSLGELSSTKVAVSIGDNVSNVVRKVARVDMKKF"
XX
SQ   Sequence 6746 BP; 1741 A; 1042 C; 1643 G; 2320 T; 0 other;

X05147  Length: 6746  December 21, 2001 16:00  Type: N  Check: 9115  ..
       1  aaattcgatt cttcccattc gccatcattg aatcattact cgtgtactgg
      51  aacgcagtta ggagtggctc caaagcatct tctttgaaaa tagattgcga
     101  agtgagttca cctaagacga cgtcggtgtt ttacgagttt ttacataatc
     151  aacatggcag attcgttcgg ttttactcca atggaggttt tgctttttgg
     201  tggtgaatcg gttcagttgt tgacttcaga catgcctatt gatgtccagt
     251  ggggctttgt atactccact cgatgttatg ctctctggaa agacgacttg
     301  attcatctca atccgctgtt gaaatattca cagcgaattg caaaacggtg
     351  ggaaaagtta gtttcgggct ttgttggccc agtaccgctt gataagttgt
     401  tgtctttgtt ggcaaaactt atgaggtatt gtgttaacat gggggtgtct
     451  gtacaggaga tatatttgtc tgatgctatt gtttcatcgt cttatatgtt
     501  gcatgtgtct aggagtgcag gttgtgtgtc ttttagttgg ttgtatgcta
     551  agttgtccat gttcgcttcg tgtggcaagt tctgggtagg gtcttcacat
     601  cacacggctg ctaacatgat tgaaggttcc cgtgctgtga atggtccgga
     651  tgtggctatt tctgagatgg ttgaagcctt ccatttagag gtgaagtcat
     701  cactcgttgt aactgtatct ttgactccta gggagaaaaa gattttggag
     751  cgagagccag gttttgtgcc gttgtacaaa cagaaaagta gagctccacg
     801  caatcaccca gtgctggctg ctcttcgtga ggttatgagg caggagtatt
     851  ccgctagttg taatattctt aatacaaagt tgaaaacact ggtagttggt
     901  gctgccagtc gtgaagttaa ttgttattcg tctaatccgt ctgtacatta
     951  ctattttgct aataaagata gtaaggattt ggtaaggacc actctggagt
    1001  tgttgcatag tgctttggct acaaagtacc gcaatatgga aagtggtgag
    1051  cgagaactca tgaataattt gaagggttgt ggttatattg tcaaaaggtc
    1101  ggtcgaaaac gctatctatg aggttgtttc cgataaagat gttgctgaag
    1151  tgttaaggta tgcgcaaact gtcgcttcaa cgaagaaaga ggcgaaaagg
    1201  aaacctaaca ctggaaagcg aaaaatggtc atgtcggaag caactcgtag
    1251  aacaatcgaa ctgcatgagt tgtcgcgtat tgtagccgaa gagaagaaga
    1301  ttcctaacca tttccacttt gatgaaagtg attttgcttc tgttggtaat
    1351  tttactcagt tggtttgtga agatgttggt tacaattttt ctgtggatgc
    1401  ttggttgcat ttgttcgagg tgaccggtgc gcagactgcc gttggttata
    1451  tggcattgcc taatgaactt ttgtttgaac attatccaat atcagattat
    1501  tatgattatt gggagggtgt tgaaaagcat ggttcattgg gtggtattac
    1551  tatttcccct ttgcggaatg gacaggttgt tggtatgccg actggggttt
    1601  ttcaacctgt tcattttgac aagacgtctg ctggtttagg tattcctggt
    1651  tcaaagatgg gtactgctga acgtgttata tgtcacatgt cagatggact
    1701  tggaaatggc tacaatcatg ttaaaagtga ttggcagacg ttgttgaaac
    1751  atcctatttt gtcttcttca aagtataatt ttgctgttga agtggattta
    1801  acgggacgtt atggttgtct tgccaccttt cggttaactc gtgtgactgg
    1851  agtcaagtat gttgctagaa ctataaaatt gcgtccagaa gataggtatg
    1901  ttcgggtatt ggatttgtta catattgtgc gtagtattag gttgaaaggg
    1951  catgccggtt tgaaagaacc ttatcagtat tttcctgtgt ataaacgtga
    2001  ggtagatacg acggtgtctt actgtttttc tattgctgaa aaatcgttga
    2051  cagtacaaaa cattgctaat tttattagac atcacattgg tggtgtttct
    2101  ttagttaaca aagaattagt atcggcgtgg cgtttgaatc cgcaacttgt
    2151  tccttcgttc gcatatgccg tttactttta tgttgttaat ttgagaggtg
    2201  agttggatgg gatgttgcag aagttaatga aaaagggtat cacatgggca
    2251  gataggttga aggctaatgt ttcagcgttt ttgcgagata tggtagatcc
    2301  tattagtttt ttgtggacgt ggttatttga gagaagatta gtcgatcaaa
    2351  tttttcagga tgggactgat gttttttacc agatggatcg tgcttgtgtt
    2401  gatgagaagg cattgcgttt gaacgatcac attaaaatta cacgagattt
    2451  tttgcctgct gacactttac ttcctgaagg atggtcttta gacgattggg
    2501  aaaaagctcc cgatagtttg aagactcttt cggcagctgc ttcgttgcca
    2551  gtagagtgcg gggcggtaaa ttgtgttggt aagtcgttta agagcgtgcg
    2601  tactctatta ccaccatctg ttgttacttc acctgttgag cagtttttca
    2651  aatctggtgg taaatttaga gatgatgccg agtttgcaga attgttgagt
    2701  gcgcactatc gctggcagat ggacaattct ttttgtgctt gtcaggtttg
    2751  tgctgctttg actggtaaaa cgggttctca agttgttgaa tgcagatgga
    2801  aagatgagtc tatgtataca ttttctatgt cacaaactga ggttgatgat
    2851  tttagaaatg agattaaggc tcaatctatt gaaaagggaa atcgttttgg
    2901  tgaattgcta ataggtgtac atcagaaaat tcctacacaa gcctttgagg
    2951  tttcagttcg actcgaatat gttaaaggtg ggcctggtac gggtaaatct
    3001  tttcttataa gatcattggc cgaccctatt agggatcttg tggttgctcc
    3051  gttcataaaa ttgcgttctg attatcagaa tcaacgagtt ggtgatgagc
    3101  ttctttcttg ggactttcac acgcctcaca aagcattgga tgttactggt
    3151  aagcaaatta tttttgttga tgagtttaca gcctacgatt ggcgtttact
    3201  agctgtgttg gcttatagaa atcatgccca tactatttac ttagttggtg
    3251  atgagcagca gactggtatt caagagggtc gtggagaagg aatttcgata
    3301  cttaacaaaa ttgatttgtc taaggtttct acacatgttc caatcatgaa
    3351  ctttagaaat cctgtccatg atgttaaggt attaaattat ctgtttgggt
    3401  ctcgtatggt tcctatgtct tccgttgaaa agggatttag tttcggggat
    3451  attaaagaat tttcgtcttt gtcaaatatc ccagacacta aaatcattca
    3501  ttattccgat gagactggtg agcatatgat gcctgattac gttaggggag
    3551  tgtcaaaaac tactgtccgt gctaatcagg gtagtaccta cgataatgtt
    3601  gttttgcctg ttttgccatc tgatttgaaa ctgattaact cagctgagtt
    3651  aaatctggta gctttatctc gtcacaggaa taagttaacc attttattgg
    3701  acaatgatgg tatgaatatt ggtgctgttt tgaaaggcat gcttgagggt
    3751  gtgccggaag aactcgaaag aagggattac attgttggga tgtaccttgg
    3801  gttacattta cctattaaga aagagttctt ctttcctgag tctgagtttg
    3851  ctaagtcgtt tagattaatg gttgctaagt atgaggcatt cgtaccttac
    3901  gatagtgatc tgccaacttt ggtttcacaa ggagatgtcg ttgttttgga
    3951  catagcacgt gtggaaaacg atattaatga tgcctttgat tgtgcagatt
    4001  tctataatct tgtgtctcgt cctaacaatt gtttagtggt agctatttca
    4051  gaatgtttag gtgtgacgct agaaaaattg gacaatctta tgcaagctaa
    4101  cgctgtgacg cttgataagt atcacgcgtg gttgtctaag aagtctccat
    4151  caacttggca agactgtaga atgtttgccg atgctctgaa ggtttccatg
    4201  tacgttaagg ttttatctga caaaccttac gatttaactt atgaggttga
    4251  tggggctggt tcctcagtga cattatattt aactggtaag gaaagcgatg
    4301  ggcattttat tgctgcccca cttagttcgt cgctttctac caatgagaga
    4351  gagtccggag ataatagtaa gaaaccggct gatgattctg acacctttga
    4401  tgctgctaat ttgtttgctg acaagggtgt ttcttccgct gatatggagg
    4451  ctttttgtgc ctatttagaa aagactttaa tggcaacaat tatgaagtat
    4501  gatttgagct tgcaatcgtg ggctaatgtg gttgatgata ctgacgattt
    4551  ttatcaaatc aatatttctg agtttcgtca gtccacgtgt tttggtaaat
    4601  tgttgtcagc gcttgaagtt ttgaaggttg atgtttcgag gaagaggttt
    4651  atatctgatt ggttgtgtaa aaatcttgag aataaacaat tccggtggcg
    4701  ttggtcttct agtgtggctt cagctagttc ggccgggtcg aatgtcgacg
    4751  atgattttgt caatatggca gggggaaaga ctgatgctaa tgctgatcct
    4801  gctgatgttt tgaggcagag ttttatggat tatgcatcgg aatttgttcc
    4851  tatccttatc gctgaatcac caatatttat gccgttggtt gagcctgaac
    4901  caatattgtc caagtgtatg gtgcctgagt ttgacgcctt tttgttaata
    4951  aaggaatttg atttggacaa tggtgctgat gagtatcaat gcgcttatct
    5001  taatgaatct gttgctaatc gtattggtga caaatttgtt tcgggtgttt
    5051  tagacactga tattatatct ccattaaatc tgaggggaca tcctattgct
    5101  gaaaatgtta aatatcacag catgtgtgtg gccccggctc agatatattt
    5151  taagcggaat cagtggcaag aattgcaggt tcaacaggct cggtacttat
    5201  ttcgaaaagt gagaaattct ccatcatcga cacaagatag tgttgcacgt
    5251  atggttgctc agctatttgt ttctgattgt ttggtgccaa atgtagctga
    5301  tactttttct gcttccaatt tgtggcgaat tatggacaaa gctatgcatg
    5351  acatggtcgc aaaaaattac caaggccaaa tggaagagga gtttacgcgt
    5401  aatgctaaac tatatcgttt tcagttgaag gatattgaaa aacctttgaa
    5451  ggacccagag actgatttgg caaaggctgg tcaagggata ttggcatggt
    5501  ctaaggaggc acatgttaag tttatggttg cttttagagt tttaaatgat
    5551  ttgttattga agtcattaaa ctctaatgtt gtttacgata acacaatgtc
    5601  tgagaccgaa tttgttggaa aaataaatgc cgccatgaat acagtaccag
    5651  atagtgctat aaacggggtt atcgatgctg ctgcttgcga ttctgggcaa
    5701  ggggttttca cccaattgat agaaagacat atttatgctg ctttgggcat
    5751  ttctgacttc tttttggatt ggtatttctc atttcgtgag aaatatgtta
    5801  tgcagtccag atatgtcaga gcacatatgt cttatgttaa gactagtgga
    5851  gaacccggca ctttgcttgg taataccatt ttaatgggtg ctatgttaaa
    5901  tgctatgctt cgtgggaccg gaccattttg tatggccatg aagggcgatg
    5951  atggttttaa aaggcaggct aatttgaaaa ttaacgatca aatgttaaag
    6001  ttgattaaaa aggaaactgt cttggatttc aaattggatt taaatgttcc
    6051  tatcactttt tgtggttatg ctttatctaa tggacatttg tttccaagtg
    6101  tttcgcgtaa attgacgaag atagcagcac acaggttccg tgagtataag
    6151  catttttgtg aataccagga atctttgcgt gattggatta aaaatcttcc
    6201  caaagaccca gctgtttatg ctgatttttt ggagtgtaac gctagcttat
    6251  cttgtcgcaa tgttgatgat gttcaacgtt ggttggatgc tattatctct
    6301  gtgtctcgaa tcgggcgtga gcaatttatg atgatgttcc cgatacggga
    6351  agtttttatg tcattgccac ccgttgagga tagtttgggt gaattatctt
    6401  ctacgaaagt ggctgtgtct attggcgaca atgtttctaa tgttgttaga
    6451  aaggttgctc gtgttgatat gaaaaagttt taatgtgtaa tatggtaata
    6501  taatacgttg tacacttgtg agtagtataa gttttaaaat aaataaaggc
    6551  catgccacag gcctcctatc ttgatgaagg ttgttgtggt tttctcgtta
    6601  ctgttttatt attgtttgag ttgcttatgt tggttcttga ttatgtggta
    6651  cataattatt gaactaattg tttgttgggt tgtaatgtac tgactgggtg
    6701  tgaattgtac cagtcattaa agggtttact atcagtatat tgatat