ID   X15983; SV 2; circular; genomic DNA; STD; VRL; 2632 BP.
XX
AC   X15983;
XX
DT   12-NOV-1990 (Rel. 25, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 14)
XX
DE   Abutilon mosaic virus subgenome DNA A
XX
KW   circular; coat protein; structural protein.
XX
OS   Abutilon mosaic virus
OC   Viruses; ssDNA viruses; Geminiviridae; Begomovirus.
XX
RN   [1]
RC   revised by [3]
RP   1-2632
RA   Jeske H.;
RT   ;
RL   Submitted (26-JUL-1989) to the EMBL/GenBank/DDBJ databases.
RL   Jeske H., Institut f Allgemeine Botanik , Universitaet Hamburg, Ohnhorst
RL   str 18, 2000 Hamburg 52, F R G.
XX
RN   [2]
RP   1-2632
RX   PUBMED; 2219703.
RA   Frischmuth T., Zimmat G., Jeske H.;
RT   "The nucleotide sequence of the abutilon mosaic virus reveals prokaryotic
RT   as well as eukaryotic features";
RL   Virology 178(2):461-468(1990).
XX
RN   [3]
RC   revised by [4]
RA   Jeske H.;
RT   ;
RL   Submitted (29-NOV-1990) to the EMBL/GenBank/DDBJ databases.
XX
RN   [4]
RP   1-2632
RA   Jeske H.;
RT   ;
RL   Submitted (14-NOV-2003) to the EMBL/GenBank/DDBJ databases.
RL   Jeske H., Biologisches Institut, Pfaffenwaldring 57, D-70550 Stuttgart,
RL   GERMANY.
XX
DR   GOA; P21947.
DR   UniProtKB/Swiss-Prot; P21947; VAL1_ABMVW.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2632
FT                   /organism="Abutilon mosaic virus"
FT                   /segment="DNA A"
FT                   /specific_host="Abutilon sellovianum REGEL"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10815"
FT   CDS             358. .1113
FT                   /gene="ORF V1"
FT                   /product="28 kDa"
FT                   /db_xref="GOA:P21942"
FT                   /db_xref="InterPro:IPR000263"
FT                   /db_xref="InterPro:IPR000650"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21942"
FT                   /protein_id="CAA34110.2"
FT                   /translation="MPKRDLPWRSMPGTSKTSRNANYSPRARIGPRVDKASEWVHRPMY
FT                   RKPRIYRTLRTADVPRGCEGPCKVQSYEQRHDISHVGKVMCISDVTRGNGITHRVGKRF
FT                   CVKSVYILGKIWMDENIKLQNHTNSVMFWLVRDRRPYGTPMDFGHVFNMFDNEPSTATV
FT                   KNDLRDRYQVLHKFYGKVTGGQYASNEQAIVKRFWKVNNHVVYNHQEAGKYENHTENAL
FT                   LLYMACTHASNPVYATLKIRIYFYDSLMN"
FT   mat_peptide     388. .1110
FT                   /gene="ORF V1"
FT                   /product="28 kDa"
FT   CDS             join(complement(1. .9),complement(1571. .2632))
FT                   /gene="ORF C1"
FT                   /product="40.2 kDa"
FT                   /db_xref="GOA:O11842"
FT                   /db_xref="HSSP:P27260"
FT                   /db_xref="InterPro:IPR001191"
FT                   /db_xref="InterPro:IPR001301"
FT                   /db_xref="UniProtKB/TrEMBL:O11842"
FT                   /protein_id="CAA34111.2"
FT                   /translation="MPPPKKFRVQAKNYFLTYPQCSLTKDEALSQLQNLETPVNKKFIK
FT                   ICRELHENGEPHLHVLIQFEGKYQCTNNRFFDLVSPTRSAHFHPNIQGAKSSSDVKSYI
FT                   DKDGDTAEWGEFQIDGRSARGGQQTANDSYAKALNAGDVQSALNILKEEQPKDYVLQNH
FT                   NIRSNLERIFAKAPEPWVPRFPLSSFTAVPEEMQEWADDYFGSGSAARPDRPLSLIVEG
FT                   DSRTGKTMWARALGPHNYLSGHLDFNGRVYSNEVEYNVIDDVAPHYLKLKHWKELLGAQ
FT                   KDWQSNCKYGKPVQIKGGIPAIVLCNPGEGSSYKEYLDKEENTGLRNWTLKNAIFITLT
FT                   APLYQEGTQAGQEEGH"
FT   CDS             complement(1255. .1644)
FT                   /gene="ORF C2"
FT                   /product="14.4 kDa"
FT                   /db_xref="GOA:P21944"
FT                   /db_xref="InterPro:IPR000942"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21944"
FT                   /protein_id="CAA34112.2"
FT                   /translation="MRSSSPSQPPSIKKAHRQAKRRAIRRRRIDLQCGCSIYFHIDCTG
FT                   HGFTHRGIHHCTSGGEWRVYLGDSKSPVFQDIQSRGPAIHQNEDIPCTNTVQPQPEESV
FT                   ASPQSLPELPSLDDFDDSFWVNLFK"
FT   mat_peptide     complement(1258. .1644)
FT                   /gene="ORF C2"
FT                   /product="14.4 kDa"
FT   CDS             complement(1110. .1508)
FT                   /gene="ORF C3"
FT                   /product="15.9 kDa"
FT                   /db_xref="InterPro:IPR000657"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21943"
FT                   /protein_id="CAA34113.1"
FT                   /translation="MDSRTGEFITVHQAENGVYIWEIANPLYFRIYKVEDPLYTRTRIY
FT                   HVQIRFNHNLRRALHLHKAYLNFQVWTTSMTASGSIYLNRFRRLVNMYLDQLGVISINN
FT                   VIRAVQFATNRTYVNYVLENHSIKFKFY"
FT   mat_peptide     complement(1113. .1508)
FT                   /gene="ORF C3"
FT                   /product="15.9 kDa"
FT   old_sequence    1580
FT                   /replace=""
FT                   /citation=[1]
FT   old_sequence    1606^1607
FT                   /replace="cct"
FT                   /citation=[1]
XX
SQ   Sequence 2632 BP; 639 A; 615 C; 625 G; 753 T; 0 other;

x15983 Length: 2632  14-NOV-2006  Type: N  Check: 3891  ..
       1  cggtggcatt tatgtaataa gaaggggtac tctggatgag ttactccact
      51  tgaggctcct caaaacttgc tcatgtaatt ggagtattgg aggtctttat
     101  atactagaac tctcattaac ggatttgcaa cacgtggcgg ccatccgcta
     151  taatattacc ggatggccgc gcgacccccc tggtgcccgt acatcccgcg
     201  cgctttttca acctttaatt tagaattaaa ggtagtccat ggcgcctcgt
     251  ccaataataa tgcgcctgac gagtcaatat aatttgaaca acttgtagcg
     301  ctaagttgtt gggttgtcta taaatgaaag ccattggccc acgagcttta
     351  acccaaaatg cctaagcgcg atctcccatg gcgatcgatg cctggaacat
     401  caaagactag tcgcaacgct aattattctc ctcgtgctcg tattgggcca
     451  agagttgaca aggcctctga atgggtgcac aggcccatgt acaggaagcc
     501  caggatctac cggacgctga ggacggccga tgtgcccaga ggctgtgaag
     551  ggccttgtaa ggtccagtcg tatgaacagc gtcatgacat ctcacatgtt
     601  ggcaaggtaa tgtgcatctc tgatgtgaca cgtggtaatg gcattaccca
     651  ccgtgtgggt aagcgtttct gtgtcaagtc tgtgtatatt ttagggaaga
     701  tttggatgga cgagaacatc aagctccaga accacacgaa cagtgtcatg
     751  ttctggttgg tccgagaccg tagaccgtat ggcacgccca tggatttcgg
     801  tcatgtgttc aacatgttcg acaacgagcc cagtactgcc actgtgaaga
     851  acgatctccg cgatcgttac caggtccttc acaagttcta tggcaaggtc
     901  acaggtggac agtatgccag caatgaacag gcaatcgtca agcgtttctg
     951  gaaggtcaac aatcatgtgg tctacaatca tcaagaggct ggcaagtacg
    1001  agaatcacac ggagaacgct ctactattgt atatggcatg tactcatgct
    1051  tctaaccccg tttatgcaac tttgaagatc cgaatctatt tctatgattc
    1101  gctcatgaat taataaaatt tgaattttat tgaatgattt tccagtacat
    1151  aatttacata cgttctgttt gtcgcaaact gaacagctct aattacattg
    1201  ttaatggaaa tcacgcctaa ctgatctaag tacatgttga ctaaacgcct
    1251  aaatctattt aaataaattg acccagaagc tgtcatcgaa gtcgtccaaa
    1301  cttggaagtt caggtaagct ttgtggagat gcaacgctct cctcaggttg
    1351  tggttgaacc gtatttgtac atggtatatc ctcgttctgg tgtatagcgg
    1401  gtcctctact ttgtatatcc tgaaatacag gggatttgct atctcccaga
    1451  tatacacgcc attctccgcc tgatgtacag tgatgaattc ccctgtgcgt
    1501  gaatccatgt cctgtacagt ctatgtggaa gtagatggag cacccgcact
    1551  gcagatcaat cctccgccgc ctaatggccc tcctcttggc ctgcctgtgt
    1601  gccttcttga tagagggggg ctgtgagggt gatgaagatc gcattcttga
    1651  gagtccagtt gcgtagacct gtattttcct ctttgtccag gtactcttta
    1701  tagctggaac cctcaccagg attgcaaagc acgattgctg ggattcctcc
    1751  tttaatttga accggcttgc cgtacttgca atttgactgc cagtcttttt
    1801  gggcccccag caattctttc cagtgcttta gctttagata gtgcggtgcg
    1851  acgtcatcaa tgacgttata ctccacttcg ttcgaataga cgcgaccatt
    1901  gaagtccagg tgtccactga gatagttatg tgggcctaac gcacgtgccc
    1951  acatcgtctt ccctgtcctt gaatcacctt cgactatgag actcaatggt
    2001  ctgtctggcc gcgcagcgga accactccca aaataatcat ccgcccactc
    2051  ctgcatctcc tcgggaacgg ccgtgaaaga ggagagggga aaccgcggaa
    2101  cccatggttc cggagccttt gcgaatattc tttcgagatt ggagcggatg
    2151  ttatgattct gaaggacata atcttttggc tgttcttcct tcaaaatgtt
    2201  taaggcagat tgaacatctc ctgcattcaa cgccttggca tatgaatcat
    2251  tagcagtctg ttggcctccc ctggcagatc tgccgtcgat ctggaattct
    2301  ccccattcag ctgtatctcc gtccttgtcg atgtaggact tgacgtcgga
    2351  gctggattta gctccctgta tgtttggatg gaaatgtgct gacctggttg
    2401  gggagaccag atcgaagaat ctgttattcg tgcattggta tttgccttcg
    2451  aactgtatga gcacatggag atgaggctcc ccattctcgt gaagctctct
    2501  acagatcttg atgaacttct tgttcactgg ggtttctagg ttttgtaatt
    2551  gggaaagtgc ctcatcttta gtaagagagc actggggata tgtgaggaaa
    2601  taatttttgg cctgtactct aaatttcttt gg