!!NA_SEQUENCE 1.0
ID   GEABMVB    standard; circular genomic DNA; VRL; 2585 BP.
XX
AC   X15984;
XX
SV   X15984.3
XX
DT   12-NOV-1990 (Rel. 25, Created)
DT   21-NOV-2003 (Rel. 77, Last updated, Version 3)
XX
DE   Abutilon mosaic virus subgenome DNA B
XX
KW   circular; coat protein; structural protein.
XX
OS   Abutilon mosaic virus
OC   Viruses; ssDNA viruses; Geminiviridae; Begomovirus.
XX
RN   [1]
RC   revised by [3]
RA   Jeske H.;
RT   ;
RL   Submitted (26-JUL-1989) to the EMBL/GenBank/DDBJ databases.
RL   Jeske H., Institut f Allgemeine Botanik , Universitaet Hamburg, Ohnhorst
RL   str 18, 2000 Hamburg 52, F R G.
XX
RN   [2]
RP   1-2581
RX   MEDLINE; 91020984.
RX   PUBMED; 2219703.
RA   Frischmuth T., Zimmat G., Jeske H.;
RT   "The nucleotide sequence of the abutilon mosaic virus reveals prokaryotic
RT   as well as eukaryotic features";
RL   Virology 178(2):461-468(1990).
XX
RN   [3]
RP   1-2585
RA   Jeske H.;
RT   ;
RL   Submitted (14-NOV-2003) to the EMBL/GenBank/DDBJ databases.
RL   Jeske H., Biologisches Institut, Pfaffenwaldring 57, D-70550 Stuttgart,
RL   GERMANY.
XX
DR   GOA; P21945.
DR   SWISS-PROT; P21945; VBR1_ABMVW.
DR   SWISS-PROT; P21946; VBL1_ABMVW.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2585
FT                   /db_xref="taxon:10815"
FT                   /mol_type="genomic DNA"
FT                   /organism="Abutilon mosaic virus"
FT                   /specific_host="Abutilon sellovianum REGEL"
FT                   /segment="DNA B"
FT   CDS             548. .1318
FT                   /db_xref="GOA:P21945"
FT                   /db_xref="SWISS-PROT:P21945"
FT                   /product="29.8 kDa"
FT                   /gene="ORF V1"
FT                   /protein_id="CAA34114.3"
FT                   /translation="MYPSRNKRGSYFNQRRQYSRNHVWKRPTAAKRHDWKRRPSNTSKP
FT                   NDEPKMSAQRIHENQYGPEFVMAQNSAISSFISYPDLGRSEPNRSRSYIRLKQLRFKGT
FT                   VKIEQVPLAMNMDGSTPKVEGVFSLVIVVDRKPHLGPSGCLHTFDELFGARIHSHGNLS
FT                   VTPALKDRYYIRHVCKRVLSVEKDTLMVDVEGSIPLSNRRINCWATFKDVDRESCKGVY
FT                   DNISKNALLVYYCWMSDTPAKASTFVSFDLDYIG"
FT   CDS             complement(1376. .2257)
FT                   /db_xref="SWISS-PROT:P21946"
FT                   /product="32.9 kDa"
FT                   /gene="ORF C1"
FT                   /protein_id="CAA34115.2"
FT                   /translation="MDSQLVNPPNAFNYIESHRDEYQLSHDLTEIILQFPSTAAQLTAR
FT                   LSRSCMKIDHCVIEYRQQVPINATGSVIVEIHDKRMTDNESLQASWTFPIRCNIDLHYF
FT                   SASFFSLKDPIPWKLYYKVCDTNVHQRTHFAKFKGKLKLSTAKHSVDIPFRAPTVRILS
FT                   KQFSEKDVDFSHVDYGKWERKPIRCASMSRIGLRGPIEIRPGESWASRSTIGTAQPDTD
FT                   SEMENELHPYRHLNRLGTSLLDPGESASIVGDQRAEPNITMSMGQLNELVRTAVQECVN
FT                   SNCQASQAKSLK"
XX
SQ   Sequence 2585 BP; 637 A; 555 C; 642 G; 751 T; 0 other;

 X15984  Length: 2585  December 2, 2003 15:00  Type: N  Check: 3819  ..
       1  cggtggcgtt tttgtaataa gaaggggtac tctggatgag ttactccact
      51  tgaggctcct caaaacttgc tcatgtaatt ggagtattgg aggtctttat
     101  atactagaac tctcattaac ggatttgcaa cacgtggcgg ccatccgcta
     151  taatattacc ggatggccgc gcgacccccc cccctggtgc tgctctcgca
     201  ctcgctctac cctggtgctc ttctcacacg cgctctccca ttggtgcggg
     251  tccttcacgc tcctcttttg gctggacctt taatttgaat taaaggtgtt
     301  tactttctcg tgcgacgtgc tttatagttt gaattgttgt cgcgcgaata
     351  ctggctatgg accattgtac ctggtcaagg acgtgtcata attggacctt
     401  gcttctgagt ctatttgcga ttaatggtgg accatctaac tatatatttg
     451  gccggatagg tacttttgtg gtaaaagact cagcaatccc ccacgttttt
     501  tcgcacctgg ctaatcgtgt tgttttttct tatattatca tctgataatg
     551  tacccgtcta ggaataaacg tggatcctac tttaatcaac gtcgacagta
     601  ttcacgcaat catgtgtgga aacggccaac tgctgcgaag agacatgact
     651  ggaagcgtcg accttcaaat acgagcaagc ccaacgacga gcccaagatg
     701  tcagcccaac gcatacatga gaatcagtat gggcctgagt ttgtaatggc
     751  ccagaactca gcgatctcgt cgttcatcag ttatcctgac ttgggtaggt
     801  ccgagcccaa ccgaagcagg tcctatatta ggttgaagca actacgcttc
     851  aaagggacgg tgaagattga acaggtacca ttggcgatga acatggacgg
     901  atctaccccc aaagtggaag gagtgttctc ccttgtcatt gttgtggatc
     951  gtaaaccaca ccttggcccg tctggttgtc tgcatacatt tgacgagctg
    1001  tttggtgcta ggatacacag tcatggtaac ctcagcgtaa cccccgcgtt
    1051  gaaagatcga tattacattc gccacgtttg caaacgtgtg ctatctgtgg
    1101  agaaggatac gctgatggta gacgtggaag gatccattcc tctctctaac
    1151  cggcgtatta attgttgggc cacgtttaag gacgtggatc gtgagtcatg
    1201  taagggtgtt tatgataaca taagtaagaa cgccctgtta gtttattact
    1251  gctggatgtc ggatacgcct gcgaaggcat ccacttttgt atcgtttgac
    1301  cttgactata ttggttaagt gaataaatga attatttaaa gttgatcatc
    1351  ttatttgtac aagcaaaaca tacaattatt tcaatgattt ggcttgagaa
    1401  gcctgacagt tactattgac acattcttgg accgctgtcc tgactaattc
    1451  gttcaactgg cccattgaca ttgtgatgtt gggctccgct ctctggtcac
    1501  ccacaatcga agcagattct ccggggtcta gaaggctggt ccccagcctg
    1551  tttaggtgtc tgtatggatg gagctcgttc tccatttctg agtccgtatc
    1601  tggctgggct gtccctatgg tgctcctgga agcccatgat tcaccaggcc
    1651  taatctcaat tgggcctcgt agtccaatcc tggacatgga cgcgcatctg
    1701  atgggcttcc tctcccattt cccataatcc acatgggaaa agtccacgtc
    1751  tttttcggag aactgtttgg acagtatcct tactgttggt gcccggaacg
    1801  gaatgtcgac tgagtgtttc gccgtggaca atttcagttt ccctttgaac
    1851  ttggcgaagt gggtccgctg atgcacgttt gtatcgcaga ctttgtagta
    1901  caatttccat ggaatggggt ctttcagcga gaagaacgaa gccgagaaat
    1951  agtggagatc tatgttgcat ctgatcggaa aagtccacga cgcctgtaaa
    2001  gactcgttgt ccgtcattct cttgtcgtgg atctccacaa tcaccgaccc
    2051  ggtggcgttg atcggtactt gttgtctgta ttctatgacg cagtgatcga
    2101  tcttcatgca gctacgactg agtctagctg tcaactgagc cgccgtggac
    2151  ggaaattgca gtattatctc agttaggtca tgggaaagtt gatattcgtc
    2201  acggtgtgac tcgatgtagt tgaaggcgtt cggaggattt actaactgag
    2251  aatccatttg gagaagatcg gccgcagcgg aactggaacc gactactgaa
    2301  gttgaacagt taagaagatg aacaattact gttgatcaag aagaatgtaa
    2351  atagaaaggg ctcttttctt cttttgagaa agtcagatat ctctgacgta
    2401  taactgagga gatggaggag gagtaactgg tgaagagtcg agttgtttga
    2451  gaaagaaaag agagttgagg aagaatttga gagagaactg gaaatgaagg
    2501  agttggtata tgaacccaga tcttctggtt gatggtatta aattggaaag
    2551  tgttcttcta cttctgagag aatctatttg ttaaa