!!NA_SEQUENCE 1.0
ID   BMPOLYPRO  standard; RNA; VRL; 2095 BP.
XX
AC   X69204;
XX
SV   X69204.1
XX
DT   24-NOV-1992 (Rel. 34, Created)
DT   21-JUL-1995 (Rel. 44, Last updated, Version 2)
XX
DE   Barley Mild Mosaic Virus sequence for polyprotein, 3' terminus
XX
KW   capsid protein; polyprotein; RNA-dependent RNA polymerase.
XX
OS   Barley mild mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Bymovirus.
XX
RN   [1]
RP   1-2095
RA   Schlichter U.H.A.;
RT   ;
RL   Submitted (12-NOV-1992) to the EMBL/GenBank/DDBJ databases.
RL   U.H.A. Schlichter, Max Planck Inst f. Zuechtungsforschung, Abt Genetische
RL   Grundlagen der, Pflanzenzuechtung, Carl von Linne Weg 10, 5000 Koeln 30,
RL   FRG
XX
RN   [2]
RP   1-2095
RA   Schlichter U., Sohn A., Peerenboom E., Schell J., Steibiss H.H.;
RT   "Molecular analysis of the capsid protein of a german isolate of barley
RT   mild mosaic virus";
RL   Unpublished.
XX
DR   SPTREMBL; Q65660; Q65660.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2095
FT                   /db_xref="taxon:12466"
FT                   /organism="Barley mild mosaic virus"
FT                   /isolate="German"
FT   mat_peptide     <1. .990
FT                   /product="RNA-dependent RNA polymerase"
FT   CDS             <1. .1746
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q65660"
FT                   /product="viral polyprotein"
FT                   /protein_id="CAA49142.1"
FT                   /translation="RSSQKIFERKTRVFTAAPITSLIAMKYYVDDFNKQFYKTHLKAPH
FT                   TVGINKFNRGWQNLYEKLNKPGWTHGSGDGSRFDSSIDGFLFDVIKDIRKHFMDTEHHK
FT                   ELDTIYEEIVNTKICLANGLVIQKNCGNNSGQPSTVVDNTLALMTAFLYAYARLTGDHA
FT                   FELMDENFVFVCNGDDNKFSISPSFMAKFGCDFSPFLSELGLTYEFDEATEDICENPYM
FT                   SLTMVRTSFGIGFSLSIERIVAILQWSRAGGVLHAYLSGIAALFESFNTPKLFNLVHTY
FT                   LLWLITEHEEELFSMMELKDMFMPLPTREQIALLHYVGTEPIVEETFLQAGHEEPDPIV
FT                   PPVPDTDLTNMAAAPPDNRRSRAVIPRGTSDWSLPEPKMRTLGFKSKINIETLANVPDG
FT                   YMNTFASVATESQRRKWEEAARGDFGITDDEKWEKLLIAACIYFADNGTSPNFDEELTM
FT                   EVNGGLNSIKEYPVRPFVVRAKKISTLRRIFRCYSIETKLMFVKLRRVPHWAIKHGCLD
FT                   EIVFDFMIPDQFTSRTALETLKQTKLAAIGVGTSNSLLTSEQTNMRTTETRRRNDYDGH
FT                   EALLR"
FT   mat_peptide     991. .1743
FT                   /evidence=EXPERIMENTAL
FT                   /product="capsid protein"
XX
SQ   Sequence 2095 BP; 565 A; 572 C; 459 G; 499 T; 0 other;

X69204  Length: 2095  December 21, 2001 16:02  Type: N  Check: 6954  ..
       1  cgctcttcac agaaaatctt cgaacggaaa acccgcgttt tcaccgctgc
      51  acccataaca agcctcattg cgatgaaata ctacgtggac gatttcaaca
     101  aacagttcta taaaacccat ctcaaagcac cgcacacagt cggcatcaac
     151  aagttcaacc gcggatggca gaatctgtat gagaagctca acaaacctgg
     201  atggacgcat gggagtgggg atggttccag gtttgacagt tccattgacg
     251  gattcctttt cgatgtcatc aaagacattc ggaagcattt catggacacg
     301  gaacatcaca aagaactcga cacaatctac gaagaaattg tcaacacgaa
     351  gatatgtctt gcaaatggcc tggtcatcca aaagaattgc gggaacaaca
     401  gtgggcagcc aagcactgtt gtggacaaca cactcgcact catgaccgct
     451  tttctctacg catatgcccg gctcactgga gatcacgcct tcgaactcat
     501  ggacgaaaac tttgttttcg tctgcaatgg tgatgacaac aagttctcca
     551  tatcacctag cttcatggcg aagtttggat gcgatttctc cccattcctc
     601  tctgagctcg ggctaaccta tgaattcgat gaagcaactg aagacatctg
     651  cgaaaacccc tacatgtcct tgacgatggt ccgcacctcg tttgggattg
     701  gtttctctct ctccatagag cgcatcgttg caatcttgca atggagtcgc
     751  gctggtggag tcctgcatgc ctacctctct ggcatcgccg ctcttttcga
     801  atccttcaac acacccaaac tcttcaatct cgtgcacaca tatctcctct
     851  ggctcatcac agagcacgag gaggaactct tctctatgat ggaactcaaa
     901  gacatgttca tgcccttgcc cactagggaa cagatagcct tgctgcacta
     951  cgttgggact gagcccatcg tggaggaaac atttctgcaa gcaggacatg
    1001  aagaaccaga ccccatcgtt cccccggttc ctgacactga tctaacgaac
    1051  atggctgccg caccacccga caacagaaga tcacgcgccg tcatccctcg
    1101  tggaaccagt gactggagcc tgcctgaacc caaaatgcga acactaggtt
    1151  tcaagtcaaa gatcaacatc gaaacacttg ccaatgtccc cgacgggtat
    1201  atgaatacct ttgcgtccgt tgcaactgag tcgcaacgca ggaaatggga
    1251  ggaggccgca cgtggcgatt tcggcatcac tgacgatgag aaatgggaga
    1301  agctgctcat tgctgcttgt atatatttcg cagacaatgg cacctcaccg
    1351  aattttgacg aggaactcac tatggaggtt aatggcggtc tcaactccat
    1401  caaagagtac cccgttcgcc cctttgtcgt cagagccaaa aagatttcca
    1451  cgctgcgcag gatctttcgc tgttactcca tcgaaacgaa gctcatgttc
    1501  gtgaagctga ggcgcgtgcc gcattgggcc ataaagcacg gatgcctcga
    1551  tgagatcgtc tttgatttca tgatccctga ccagttcacc tctaggactg
    1601  cacttgaaac actgaagcag accaagcttg ctgccattgg tgttggcaca
    1651  agcaactctc tcctcacctc cgagcaaacg aacatgagga ccactgaaac
    1701  ccgacggcgc aatgactacg atggtcacga ggcgcttctc cggtagatct
    1751  ctcatgcact cacatttcct tttaagcaat gcatttcaat acgcttttaa
    1801  tcatatcaag cgtcaagaat tcctcccgct tgcagctaat ccttacaggg
    1851  tggcactttg tgttatgcaa tggaaaattc agtgacgcaa tcaaccatca
    1901  ttggttggtg acaacgcagt actttcttta tttcacatca agcgaccagc
    1951  acatcgcccg cttacagcta atcctacctg agggtggcac tctgtgttat
    2001  gtaatggaat gtgcaatctc gcaaccaacc gtcattggtt gatggtgcgg
    2051  ctaacacccg cactcttgta taccggaaag gttaaaaaaa aaaaa