ID   X73476; SV 1; linear; genomic RNA; STD; VRL; 15480 BP.
XX
AC   X73476;
XX
DT   08-JUL-1993 (Rel. 36, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 11)
XX
DE   Beet yellows virus (isolate Ukrainian BYV-U) complete genome
XX
KW   coat protein; heat shock 70-related protein; heat shock 90-related protein;
KW   methyltransferase; papain-like protease; RNA dependent RNA polymerase;
KW   RNA helicase.
XX
OS   Beet yellows virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RX   PUBMED; 8259666.
RA   Agranovsky A.A., Koonin E.V., Boyko V.P., Maiss E., Froetschl R.,
RA   Lunina N.A., Atabekov J.G.;
RT   "Beet yellows closterovirus: complete genome structure and identification
RT   of a leader papain-like thiol protease.";
RL   Virology 198(1):311-324(1994).
XX
RN   [2]
RP   1-15480
RA   Agranovsky A.A.;
RT   ;
RL   Submitted (18-JUN-1993) to the EMBL/GenBank/DDBJ databases.
RL   A.A. Arganovsky, A.N. Belozersky Institute, Moscow State University, 119899
RL   Moscow, Russia
XX
CC   Related sequence: X53462
XX
FH   Key             Location/Qualifiers
FH
FT   5'UTR           1. .107
FT   source          1. .15480
FT                   /organism="Beet yellows virus"
FT                   /isolate="Ukrainian (BYV-U)"
FT                   /mol_type="genomic RNA"
FT                   /clone="pBYV p36, x19, R9, R3, 36A, R2, 36, p43, 111-7,
FT                   112, 115, 1213, 1210, 124, 1313, 1311, 142, 143, 1311,
FT                   1311, 142, 143, 156, 1510, 154, 1518,1520, 169, 1615, 175"
FT                   /db_xref="taxon:12161"
FT   misc_signal     7983. .8045
FT                   /note="+1 ribosomal frameshift signal"
FT   CDS             9444. .9608
FT                   /note="putative membrane-binding protein"
FT                   /db_xref="GOA:Q08542"
FT                   /db_xref="InterPro:IPR009591"
FT                   /db_xref="UniProtKB/TrEMBL:Q08542"
FT                   /protein_id="CAA51864.1"
FT                   /translation="MDCVLRSYLLLAFGFLICLFLFCLVVFIWFVYKQILFRTTAQSNE
FT                   ARHNHSTVV"
FT   CDS             9608. .11404
FT                   /product="heat shock 70-related protein"
FT                   /db_xref="GOA:P37092"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37092"
FT                   /protein_id="CAA51865.1"
FT                   /translation="MVVFGLDFGTTFSSVCAYVGEELYLFKQRDSAYIPTYVFLHSDTQ
FT                   EVAFGYDAEVLSNDLSVRGGFYRDLKRWIGCDEENYRDYLEKLKPHYKTELLKVAQSSK
FT                   STVKLDCYSGTVPQNATLPGLIATFVKALISTASEAFKCQCTGVICSVPANYNCLQRSF
FT                   TESCVNLSGYPCVYMVNEPSAAALSACSRIKGATSPVLVYDFGGGTFDVSVISALNNTF
FT                   VVRASGGDMNLGGRDIDKAFVEHLYNKAQLPVNYKIDISFLKESLSKKVSFLNFPVVSE
FT                   QGVRVDVLVNVSELAEVAAPFVERTIKIVKEVYEKYCSSMRLEPNVKAKLLMVGGSSYL
FT                   PGLLSRLSSIPFVDECLVLPDARAAVAGGCALYSACLRNDSPMLLVDCAAHNLSISSKY
FT                   CESIVCVPAGSPIPFTGVRTVNMTGSNASAVYSAALFEGDFVKCRLNKRIFFGDVVLGN
FT                   VGVTGSATRTVPLTLEINVSSVGTISFSLVGPTGVKKLIGGNAAYDFSSYQLGERVVAD
FT                   LHKHNSDKVKLIHALTYQPFQRKKLTDGDKALFLKRLTADYRREARKFSSYDDAVLNSS
FT                   ELLLGRIIPKILRGSRVEKLDV"
FT   CDS             11310. .12971
FT                   /note="putative heat shock 90-related protein"
FT                   /db_xref="GOA:Q08541"
FT                   /db_xref="InterPro:IPR004909"
FT                   /db_xref="UniProtKB/TrEMBL:Q08541"
FT                   /protein_id="CAA51866.1"
FT                   /translation="MTTRFSTPANYYWGELFRRFFGGQEWKNLMSEAASVSRPRYSSDF
FT                   RFSDGVILSRKTFGESTGESFVREFSLLLTFPKTYEVCKLCGVAMELALNGMNRLSDYN
FT                   VSEFNIVDVKTVGCKFNIQSVTEFVKKINGNVAEPSLVEHCWSLSNSCGELINPKDTKR
FT                   FVSLIFKGKDLAESTDEAIVSSSYLDYLSHCLNLYETCNLSSNSGKKSLYDEFLKHVID
FT                   YLENSDLEYRSPSDNPLVAGILYDMCFEYNTLKSTYLKNIESFDCFLSLYLPLLSEVFS
FT                   MNWERPAPDVRLLFELDAAELLLKVPTINMHDSTFLYKNKLRYLESYFEDDSNELIKVK
FT                   VDSLLTRDNPELKLAQRWVGFHCYYGVFRTAQTRKVKRDAEYKLPPALGEFVINMSGVE
FT                   EFFEELQKKMPSISVRRRFCGSLSHEAFSVFKRFGVGFPPITRLNVPVKYSYLNVDYYR
FT                   HVKRVGLTQDELTILSNIEFDVAEMCCEREVALQARRAQRGEKPFQGWKGTKNEISPHA
FT                   RSSIRVKKNNDSLLNILWKDVGARSQRRLNPLHRKH"
FT   CDS             12919. .13569
FT                   /product="coat protein homolog"
FT                   /db_xref="GOA:Q08538"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q08538"
FT                   /protein_id="CAA51867.1"
FT                   /translation="MLAPEARGDLIHFTENTRDAMETFFNSYDLAEYSEVNPNKLNRKE
FT                   TDELLGVIRERFKSELVITDEDFVKHLAFALIRAANITTSVKVNYVGAYEYTIGGKKFL
FT                   VKDAWVFPLIKECMKKFNKPNPVRTFCATFEDAYIVIARSLPKLFLNRTIGKRGIPSGY
FT                   EFLGADFLTATSVCLNDHEKAIVLQASRAAIDRAVSSSVDGKIVSLFDLGRLS"
FT   CDS             13640. .14254
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q08531"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="UniProtKB/TrEMBL:Q08531"
FT                   /protein_id="CAA51868.1"
FT                   /translation="MGSAEPISAIATFENVSLADQTCLHGEDCDKLRKNFEECLKLKGV
FT                   PEDNLGIALGLCLYSCATIGTSNKVNVQPTSTFIKASFGGGKELYLTHGELNSFLGSQK
FT                   LLEGKPNKLRCFCRTFQKDYISLRKEYRGKLPPIARANRHGLPAEDHYLAADFISTSTE
FT                   LTDLQQSRLLLARENATHTEFSSESPVTSLKQLGRGLGTGR"
FT   CDS             14251. .14793
FT                   /note="orf7"
FT                   /db_xref="GOA:Q08544"
FT                   /db_xref="UniProtKB/TrEMBL:Q08544"
FT                   /protein_id="CAA51869.1"
FT                   /translation="MTSSVELAQTKPLFRVLLLKGFVFYVVAFETEEESSEAELPLVYL
FT                   HDFELNINKRGKIEASYVDFMSCMTRLKPSSVSYTRVSSEKSSEDFSLPGSGKTFGSKV
FT                   LNRKVTFTFENGVQLVFGMYGLEQRCVSSDYLWFENVFVGAHCGTLTYCLNCELDKSGG
FT                   ELEILTFSKNEVLLKRW"
FT   CDS             14768. .15301
FT                   /note="orf8"
FT                   /db_xref="GOA:Q08545"
FT                   /db_xref="PDB:2CWO"
FT                   /db_xref="UniProtKB/TrEMBL:Q08545"
FT                   /protein_id="CAA51870.1"
FT                   /translation="MKFFLKDGETSRALSRSESLLRRVKELGTNSQQSEISECVDEFNE
FT                   LASFNHLLVTVEHREWMEQHPNQSSKLRVPSRIGEMLKEIRAFLKVRVVTPMHKETASD
FT                   TLNAFLEEYCRITGLAREDALREKMRKVKSVVLFHHSELLKFEVTENMFSYTELLKLNL
FT                   SLRVISSQILGMAI"
FT   3'UTR           15299. .15480
FT   CDS             join(108. .7983,8045. .9393)
FT                   /gene="ORF1a/b"
FT                   /product="fusion protein of papin-like protease,
FT                   methyltransferase, RNA helicase"
FT                   /db_xref="GOA:Q08534"
FT                   /db_xref="InterPro:IPR000606"
FT                   /db_xref="InterPro:IPR001788"
FT                   /db_xref="InterPro:IPR002588"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR008749"
FT                   /db_xref="UniProtKB/TrEMBL:Q08534"
FT                   /protein_id="CAA51871.1"
FT                   /translation="MAFLNVSAVPSCAFAPAFAPHAGASPIVPDSFPCVPRYSDDISHF
FT                   RLTLSLDFSVPRPLSLNARVHLSASTDNPLPSLPLGFHAETFVLELNGSSAPFSIPSRH
FT                   IDFVVNRPFSVFPTEVLSVSSLRTPSRLFALLCDFFLYCSKPGPCVEIASFSTPPPCLV
FT                   SNCVAQIPTHAEMESIRFPTKTLPAGRFLQFHKRKYTKRPETLIIHESGLALKTSALGV
FT                   TSKPNSRPITVKSASGEKYEAYEISRKDFERSRRRQQTPRVRSHKPRKINKAVEPFFFP
FT                   EEPKKDKRKRASLPTEDEGFITFGTLRFPLSETPKEEPRLPKFREVEIPVVKKHAVPAV
FT                   VSKPVRTFRPVATTGAEYVNARNQCSRRPRNHPILRSASYTFGFKKMPLQRFMKEKKEY
FT                   YVKRSKVVSSCSVTKSPLEALASILKNLPQYSYNSERLKFYDHFIGDDFEIEVHPLRGG
FT                   KLSVLLILPKGEAYCVVTAATPQYHAALTIARGDRPRVGELLQYRPGEGLCYLAHAALC
FT                   CALQKRTFREEDFFVGMYPTKFVFAKRLTEKLGPSALKHPVRGRQVSRSLFHCDVASAF
FT                   SSPFYSLPRFIGGVEEEAPEITSSLKHKAIESVYERVSIHKDNLLARSVEKDLIDFKDE
FT                   IKSLSKEKRSVTVPFYMGEAVQSGLTRAYPQFNLSFTHSVYSDHPAAAGSRLLENETLA
FT                   SMAKSSFSDIGGCPLFHIKRGSTDYHVCRPIYDMKDAQRRVSRELQARGLVENLSREQL
FT                   VEAQARVSVCPHTLGNCNVKSDVLIMVQVYDASLNEIASAMVLKESKVAYLTMVTPGEL
FT                   LDEREAFAIDALGCDVVVDTRRDMVQYKFGSSCYCHKLSNIKSIMLTPAFTFSGNLFSV
FT                   EMYENRMGVNYYKITRSAYSPEIRGVKTLRYRRACTEVVQVKLPRFDKTLKTFLSGYDY
FT                   IYLDAKFVSRVFDYVVSNCSVVNSKTFEWVWSYIKSSKSRVVISGKVIHRDVHIDLKHS
FT                   ECFAAVMLAVGVRSRTTTEFLAKNLNYYTGDASCFETIRFLFREWSRRAYAEINRSFRK
FT                   LMKSILSAGLDYEFLDLDNSLQHLLEYSEVEVRVSIAQNGEVDCNEENRVLTEIIAEAA
FT                   DRKSIAQGLSGALSSVPTQPRGGLRGGSRRSGVSFLYNLVEEVGNLFFSVGDAVRFLVK
FT                   VFKTFSDSPIFRVVRMFLDLAEAASPFVSVVSLCAWLREAVSAFSSWVADRTVSESVKT
FT                   FVNRTVKRFLNFMSAKTLTKKFFRFFLSASALAKTVVRKAKVILEAYWEVWFESILSDS
FT                   GEYSAVEFCSSVVITLLTNSGRLLPGFSPSAIITEVLLDLATKISIEVLLKQISPADST
FT                   ASSALYRRVLSEILSNFRTMGEHGIFTKVFLLCGFLPVFVRKCVALCVPGDMATYARFL
FT                   EYGVDDLFFLGRSVNSIKNYLCVVAAGLVDSIVDSVVLKLSGVAKERVLGFKSKIIKNF
FT                   LNVFRKAKVVTRTSSSTDLSEDEYFSCDESKPGLRGGSSRFTLSRLLDIFFNFLKSSKL
FT                   VIENACFSAYERIERNMKLYFFPLNSSEEEARRLIRCAGDFDYLSDSAFDEDEMLRQAF
FT                   EQYYSSDDESVTYDGKPTVLRSYLNVSRRFLETFCNGPKFFVKVSNYFKALYSRLLRVL
FT                   PWVDRNLSDSPGLKGGNEKALLAKFFKTCVITACECVSQICCLRLIRLCWGTPACGLVR
FT                   LFYITYSSTRVLSRVVVAVAVCPLLVRNELDGLSDGLTNMGVSVFRRLFVALRRALSAY
FT                   SNSALRRKIIEFIFGNIHHPFDVAVIETNEVAPEPLSPEVDIDVDCDFGSDSESVSSDE
FT                   VASNPRPGLHGGSRRSSNFLTSLVKVVFKLARRIPRLLFRLRNFVAYFVERRLASKRLK
FT                   TFIGLARLFDNFSLTSVVYLLQEYDSVLNAFIDVELILLNSGSVNVLPLVSWVRGSLTK
FT                   LAEAIVGSGFASFLGRMCCRVSDWCSSSSNAGCNFMSPVRTKGKFVPPSSSGSTASMYE
FT                   RLEALESDIREHVLSTCRVGSDEEEERPKEVTEPGIEHTSEDVVPIRSHSQPLSGGECS
FT                   YSEDREENERANLLPHVSKIVSERRGLETARRNKRTLHGVSEFLNAINTSNEQPRPIIV
FT                   DHSPESRALTNSVREFYYLQELALFELSCKLREYYDQLKVANFNRQECLCDKDEDMFVL
FT                   RAGQGVVSGRNSRLPLKHFKGHEFCFRSGGLVPYDGTSRVDTIFHTQTNFVSANALLSG
FT                   YLSYRTFTFTNLSANVLLYEAPPGGGKTTTLIKVFCETFSKVNSLILTANKSSREEILA
FT                   KVNRIVLDEGDTPLQTRDRILTIDSYLMNNRGLTCKVLYLDECFMVHAGAAVACIEFTK
FT                   CDSAILFGDSRQIRYGRCSELDTAVLSDLNRFVDDESRVYGEVSYRCPWDVCAWLSTFY
FT                   PKTVATTNLVSAGQSSMQVREIESVDDVEYSSEFVYLTMLQSEKKDLLKSFGKRSRSSV
FT                   EKPTVLTVHEAQGETYRKVNLVRTKFQEDDPFRSENHITVALSRHVESLTYSVLSSKRD
FT                   DAIAQAIVKAKQLVDAYRVYPTSFGGSTLDVSVNPSTSDRSKCKASSAPYEVINSFLES
FT                   VVPGTTSVDFGDVSEEMGTQVFESGADNVVIRDSAPVNKSTDHEENLYSYESRNYNFTV
FT                   CERFSGPQEFGQAMAMVMLERSFDLEKVAKVRSDVIAITEKGVRTWMSKREPSQLRALS
FT                   SDLQKPLNLEEEITTFKLMVKRDAKVKLDSSCLVKHPPAQNIMFHRKAVNAIFSPCFDE
FT                   FKNRVITCTNSNIVFFTEMTNSTLASIAKEMLGSEHVYNVGEIDFSKFDKSQDAFIKSF
FT                   ERTLYSAFGFDEDLLDVWMQGEYTSNATTLDGQLSFSVDNQRKSGASNTWIGNSIETLG
FT                   ILSMFYYTNRFKALFVSGDDSLIFSESPIRNSADAMCTELGFETKFLTPSVPYFCSKFF
FT                   VMTGHDVFFVPDPYKLLVKLGASKDEVDDEFLFEVFTSFRDLTKDLVDERVIELLTHLV
FT                   HSKYGYESGDTYAALCAIHCIRSNFSSFKKLYPKVKGWVVHYGKLKFVLRKFANCFREK
FT                   FDTAFGERTFLLTTKLETVL"
FT   exon            108. .7983
FT                   /number=1
FT   exon            8045. .9393
FT                   /number=2
FT   intron          7984. .8044
FT                   /number=1
XX
SQ   Sequence 15480 BP; 3891 A; 3446 C; 3680 G; 4463 T; 0 other;

x73476 Length: 15480  14-NOV-2006  Type: N  Check: 9225  ..
       1  gtttttaacc atccttctac tagacgtaca ctcgtacatc ctctagtatt
      51  tcctttattt atcttcccat aagcccctgc ctttaacgtt taactctcgc
     101  tatcgacatg gcattcttga acgtttctgc tgtccccagc tgtgctttcg
     151  cacctgcttt cgcaccccac gccggtgcaa gccccattgt gcccgacagt
     201  ttcccttgcg taccccgtta ttcggacgac atatcccatt tccgtttaac
     251  gttgtcgctt gacttctctg tcccacgccc gctctctttg aacgcgcgtg
     301  tgcacttgag tgcttctacc gacaacccct taccatcgct tccccttggt
     351  ttccacgctg aaacctttgt tttggaattg aacggcagtt cggctccctt
     401  ctctataccg tcccgccaca ttgacttcgt tgtgaaccgg cctttctccg
     451  tgttccctac tgaagtcctc tccgtcagtt cccttcgaac accttctagg
     501  ttgttcgctc ttttatgcga ctttttcctt tactgttcca aaccaggtcc
     551  ttgcgttgaa attgcttctt tttcaactcc accaccctgt ttagtttcga
     601  actgcgttgc acaaattccc acgcacgccg aaatggaaag tattcgtttt
     651  ccaacgaaga ctcttccagc tggtcggttc ttacagttcc acaaacgaaa
     701  atacacgaaa cgacctgaaa ctctaatcat acacgagagc ggcttggctc
     751  tcaaaaccag cgcgttaggt gttacatcga aacctaattc gcgccctatc
     801  accgtgaaat ctgcttccgg tgaaaaatat gaagcttacg agatctctcg
     851  taaagacttc gaacgctccc gcaggaggca acaaactcct cgcgttcgtt
     901  ctcacaagcc ccggaagata aataaagctg tcgaaccttt cttctttcca
     951  gaagaaccaa agaaagacaa acggaagaga gcttctcttc cgactgaaga
    1001  tgaaggtttc attacttttg ggaccttgcg ctttccgctt tcggaaaccc
    1051  ctaaggaaga acctcgtctt cctaaatttc gggaagttga aattcctgta
    1101  gtcaagaaac atgctgtacc agcagtagtt tctaaaccag ttcgaacgtt
    1151  tagaccagtc gctaccactg gcgctgagta tgtcaacgct cggaaccagt
    1201  gttcgcgccg tccaagaaat catccgattt tacgcagtgc ttcttatact
    1251  ttcggtttta agaaaatgcc gctccagcgt ttcatgaaag aaaagaaaga
    1301  atactacgtg aagcgctcta aggtcgtgag tagttgtagt gtaactaaaa
    1351  gtcctttgga agctttggcc agcatactaa agaacttacc acagtattcc
    1401  tacaactcag aacggttaaa attttacgat cattttatcg gcgacgactt
    1451  tgaaattgaa gtgcatccgc tgcgaggcgg caaattaagt gtgcttctta
    1501  ttttgcctaa gggcgaagct tactgcgtag tcactgcggc cacgccgcag
    1551  taccacgctg ctttaactat tgcgcgtggc gatcgtcctc gcgttggtga
    1601  acttttgcag taccgacccg gcgaagggtt atgttacctc gcccacgctg
    1651  ctctttgttg cgctcttcag aagcgcacct ttcgcgaaga agacttcttc
    1701  gttggtatgt acccgacgaa gtttgtcttc gctaaacgac tcactgaaaa
    1751  gttgggtcct agtgctctca aacatcctgt gcgcggaaga caagtctctc
    1801  gttcactctt ccactgtgat gtggcttctg ctttttcgag ccccttttac
    1851  agtttgccgc gtttcatcgg cggcgtggaa gaagaagctc ctgagatcac
    1901  gtcgtctctt aagcacaagg cgatcgaatc ggtctacgaa cgtgtcagca
    1951  ttcacaaaga caacttgttg gctcgtagcg tggaaaagga tttgatcgac
    2001  tttaaagacg aaatcaagtc gctgtcgaag gaaaaacgtt ccgttaccgt
    2051  ccccttctat atgggggagg ccgtacagag tggtttgacg cgcgcgtacc
    2101  ctcagtttaa tttgagtttc actcacagtg tctattcgga ccaccctgcg
    2151  gcggccggtt cccgtctgtt ggaaaacgaa actttagcct cgatggctaa
    2201  atcttccttt tctgatatag ggggctgccc gctttttcac ataaagaggg
    2251  ggagcacaga ttaccacgtg tgcagaccga tttacgacat gaaggacgct
    2301  caacgaagag tttcgaggga actccaagcg agagggctgg tggaaaacct
    2351  ttcccgcgaa caacttgttg aagctcaggc gcgcgtttcg gtgtgccctc
    2401  acactctcgg caattgtaac gtgaaaagcg acgtgctaat catggtgcag
    2451  gtttacgacg catctttgaa cgaaattgcg tcggcgatgg tcctaaagga
    2501  atcgaaagtc gcttacctca ccatggtgac tccgggtgaa cttctagatg
    2551  aacgcgaagc cttcgctatc gacgctttgg ggtgcgacgt cgtcgtggac
    2601  acccgccgag acatggtgca gtacaaattc ggatcatctt gttactgcca
    2651  caaactgtcg aatataaaga gtataatgtt gactcccgca ttcactttca
    2701  gcgggaatct tttttcggtc gagatgtacg aaaaccgaat gggcgtcaac
    2751  tactacaaaa tcactcgttc agcgtattct cctgagatac gcggcgttaa
    2801  gacgctgcgg taccgccgag cctgcaccga ggtcgtgcaa gttaaactgc
    2851  cacgcttcga taaaactcta aagacgtttc tctccgggta tgattacata
    2901  tatttggatg cgaaattcgt ctctcgagtc ttcgattacg tggttagcaa
    2951  ctgtagcgtt gttaacagta aaaccttcga gtgggtgtgg agttacataa
    3001  aatcaagtaa atcgcgcgtt gtcataagtg ggaaagtgat acatcgagat
    3051  gtgcatatcg acctcaaaca ctctgaatgt tttgcggctg tgatgctcgc
    3101  ggttggggtg cgttctcgca caactactga atttttagcg aagaacctca
    3151  attattacac tggcgatgct tcgtgctttg agactatccg tttcctcttt
    3201  cgggagtgga gccggagggc ttacgcggaa ataaatcgca gttttcgaaa
    3251  gcttatgaag agcattcttt ccgctgggtt agattacgaa tttctcgatc
    3301  ttgacaactc gctccaacac ttgcttgaat actcagaggt tgaagtgcgc
    3351  gtttcaatcg ctcagaatgg tgaggtggat tgcaacgaag agaaccgtgt
    3401  tttgacggag ataatagccg aagcagcgga caggaaatct atcgctcaag
    3451  gtctcagcgg agcgttgagc tccgttccaa cgcaaccgag aggcggtctg
    3501  agagggggta gtcgccgaag tggagtttct ttcctttata acttggtaga
    3551  ggaagtcgga aatcttttct tttccgtcgg tgatgccgtg cggtttcttg
    3601  ttaaggtttt taaaactttt tccgactctc ccatctttcg ggtcgttcgg
    3651  atgttcctgg acttggcgga agcagcttca ccgttcgttt cggttgtttc
    3701  tttgtgcgcg tggttgcgcg aagctgtaag cgctttctca agctgggttg
    3751  ccgacagaac ggtgtcggaa agtgtaaaaa cctttgtaaa ccgtacggta
    3801  aaaaggtttc taaactttat gtctgcaaaa accctgacga aaaaattttt
    3851  taggtttttc ttatccgctt ccgccttagc taaaaccgtt gtgaggaagg
    3901  cgaaggtgat tttggaagct tactgggaag tgtggttcga atcgattctt
    3951  tcggatagtg gagagtacag tgctgttgaa ttttgtagca gcgttgtgat
    4001  cacactgtta acgaattccg gtcggctgct acctgggttt agtccatccg
    4051  ctatcattac tgaagtactg cttgacctag ccacgaaaat atccattgaa
    4101  gttcttctaa aacaaatttc tcctgccgac tcgacagctt cttcggcctt
    4151  atatcgccgc gtcctaagcg agattctgtc gaattttcgc acaatgggcg
    4201  aacacgggat cttcactaaa gtctttttac tctgcgggtt tctacccgtg
    4251  tttgttagga agtgcgtcgc tctgtgcgtt cctggtgaca tggcgacgta
    4301  cgcccggttt ctcgaatacg gggtcgacga tctcttcttt ttgggaaggt
    4351  ccgtgaactc gattaagaac tacctatgtg tggtcgctgc cgggttggtg
    4401  gactccattg tcgattccgt tgttttgaaa ctttccggtg tcgccaaaga
    4451  gcgagtgctt ggttttaaat caaaaatcat aaagaatttt ttaaacgtct
    4501  ttaggaaggc gaaagtcgtt acacgtactt cttccagcac ggacttgtcg
    4551  gaagacgaat atttttcgtg cgacgaaagc aaacccggct tgagaggcgg
    4601  ttcctctagg ttcacgcttt cgcgattgct tgacatcttt ttcaatttcc
    4651  tgaaaagttc aaagctcgtc atagagaatg cgtgcttttc tgcttacgaa
    4701  aggattgaaa ggaacatgaa actatacttt tttcctttaa attcttcgga
    4751  agaagaagct cgccgcttaa ttcggtgcgc gggagacttc gactacttaa
    4801  gcgatagcgc tttcgacgaa gatgaaatgt tacggcaagc tttcgaacaa
    4851  tactattcca gtgacgacga gagtgtaact tacgatggaa aacccacagt
    4901  tctccgtagt tacttgaacg tgagtagaag gttcttggaa acgttctgta
    4951  acggcccgaa gtttttcgtc aaagtttcga attactttaa agcgctgtat
    5001  agtcgtttgc tccgtgttct accgtgggta gacagaaatc tttctgactc
    5051  gccaggactt aaaggaggta acgagaaagc tcttcttgcg aagttcttta
    5101  aaacctgcgt cataaccgct tgcgaatgtg tgtcgcagat atgctgcctg
    5151  cgtcttattc gcttatgttg ggggacacca gcgtgtggtt tagttaggtt
    5201  attttacata acttattcca gtactcgcgt gttgtcgcgt gttgtggtcg
    5251  cggtggctgt atgccctctt ttggtcagaa acgaactgga tggcttgagt
    5301  gatggattaa ccaacatggg cgtttcggtt tttcgtcgct tgttcgtcgc
    5351  ccttcggcgc gcgctttcgg cgtactctaa ttccgcccta cgacggaaga
    5401  ttatcgaatt cattttcgga aacattcacc acccttttga tgtcgcagta
    5451  atcgaaacaa acgaagttgc gccggaacct ctttcaccgg aagtagacat
    5501  tgatgtcgac tgcgactttg gttccgattc agaatcggtt tcttcagatg
    5551  aagtcgcgtc gaatccccgt ccaggcttac acggtgggag taggcgctct
    5601  tccaactttc taacctctct cgtgaaggtt gtttttaaat tggctaggcg
    5651  cattccgcgt ttgcttttcc gtttgcgcaa ttttgtggcg tactttgttg
    5701  aacgacggct ggcttcaaaa aggttgaaga cattcatcgg tctggccagg
    5751  ctgtttgata atttctcact cacttcggtg gtttaccttc tccaagagta
    5801  cgattcagtg ctgaacgcat ttatagacgt cgagctaatc ctacttaact
    5851  cgggtagcgt gaatgtgcta cctttagttt cttgggtcag gggatctcta
    5901  acgaagttag cggaagcgat cgttggttca ggcttcgctt cgtttctagg
    5951  aaggatgtgc tgtcgtgtgt ctgactggtg ctcctcgtct tcgaacgccg
    6001  gttgtaactt tatgagtccg gttcgtacga aagggaagtt cgttccccct
    6051  tcgtcttccg gttcaaccgc ttcgatgtat gaacgtctcg aagctctcga
    6101  gagcgatatc cgcgaacacg tgctttccac gtgtcgtgta ggaagcgacg
    6151  aagaagaaga aaggccgaaa gaagtgacag aaccaggaat tgaacatact
    6201  tctgaagatg ttgttcctat tcgttcacac tcgcaaccct tatctggagg
    6251  tgaatgttcg tattctgaag atcgtgaaga gaatgaacga gcgaacctgt
    6301  taccgcacgt tagcaaaatc gtcagtgaac gaaggggttt ggagaccgcc
    6351  cgtcgaaaca aacgtactct acatggtgta agcgagtttc tcaacgctat
    6401  taatactagc aatgagcaac ctaggccgat aatcgttgac cactctcccg
    6451  aatctcgcgc gttgaccaac tccgtgaggg aattctatta cctccaggaa
    6501  ctcgctcttt ttgagttgag ttgcaaactt cgtgagtatt acgatcaatt
    6551  gaaggttgcg aattttaaca gacaagagtg tttgtgcgac aaagacgaag
    6601  acatgtttgt tctacgagcc ggacaaggtg tagtttccgg cagaaactcg
    6651  aggttgcctc ttaagcattt caagggtcac gaattttgtt ttcgatctgg
    6701  agggttggtc ccttacgacg gtaccagcag agtggacacc atttttcaca
    6751  cgcaaacgaa tttcgtttcc gcgaacgcgc ttctttcggg ctatctctcc
    6801  tatagaactt tcactttcac taatttgagc gctaacgtac tgctgtacga
    6851  agctcctcca ggtggtggaa agaccacgac tttgataaag gttttttgtg
    6901  aaactttttc aaaagttaat tcgctgattt taacggcgaa taagagttcg
    6951  cgagaagaaa tacttgcgaa ggtgaatcgc atcgtacttg acgaaggcga
    7001  tacgcctctt cagacgcgtg acaggatttt aactatcgat tcttatctaa
    7051  tgaacaacag aggtttgacg tgtaaggttt tgtacctcga tgagtgtttc
    7101  atggttcacg ctggagctgc tgtagcttgc atcgaattca ccaaatgcga
    7151  ttcagccatc ttatttggag acagcaggca aattcgttac ggtcgatgta
    7201  gtgaattgga tactgctgtt ctttcagatt tgaaccgttt tgtcgatgac
    7251  gaatcgagag tatatggtga agtctcatac aggtgtcctt gggacgtttg
    7301  tgcttggttg tcaactttct acccgaaaac tgtggccact accaacttgg
    7351  tttcagccgg tcaatcttcg atgcaagtac gcgagattga aagcgtagac
    7401  gacgtcgaat attccagtga attcgtctac ttgactatgt tacagtcaga
    7451  gaagaaagat ctgctgaaat ctttcggcaa gaggtctcgt tcgagcgttg
    7501  agaaacccac ggtcttaaca gtccatgaag ctcagggtga aacctaccgc
    7551  aaagttaacc tcgtcagaac gaaatttcaa gaggacgatc cttttcggag
    7601  cgagaaccac atcacagtgg ccttgtctag gcatgtcgag agtctgacct
    7651  attcggtcct gagtagtaaa cgtgacgacg caatagccca agctatagtg
    7701  aaggcgaaac aacttgtgga tgcctatcgc gtttacccca cgtcatttgg
    7751  tgggagtact cttgatgtta gtgttaaccc ttctacttct gacaggagca
    7801  aatgtaaagc ttcctctgcc ccttacgaag ttataaacag cttcttggag
    7851  agcgtggttc cgggcactac ttcagtagac tttggggacg tttccgaaga
    7901  gatgggtact caggtttttg agtccggtgc tgataacgtt gttattcgtg
    7951  attccgcacc tgttaacaag tcgacggatc acgacccgca gcgggtttag
    8001  ctcgattcgc tcgcaggcga ttcctaagag gaaaccgtcg ctgcaagaga
    8051  atttatactc ttatgagtcg cgtaattaca actttaccgt ttgtgaacgt
    8101  ttttccggac cgcaggagtt cggacaggcg atggcgatgg ttatgttgga
    8151  acgaagcttt gacttagaga aagttgctaa agttagaagc gatgtgatcg
    8201  ccataacaga aaaaggggtg cgaacatgga tgtcaaaacg tgaaccttct
    8251  cagcttaggg ctcttagtag tgacttacaa aagcctctaa acttggaaga
    8301  ggaaataacg acttttaagt tgatggttaa gcgggacgcg aaagtcaaac
    8351  tcgattcgtc gtgtttggtg aaacacccac cagcgcagaa tataatgttc
    8401  catcgcaagg cggtgaacgc gattttctcg ccgtgtttcg acgagtttaa
    8451  aaatagagtc attacctgta cgaattcaaa tattgttttc tttaccgaaa
    8501  tgactaactc tactctcgcg tcgatagcga aagagatgct ggggagcgaa
    8551  cacgtttaca acgttgggga aatagacttt tcgaaattcg acaaatccca
    8601  agacgctttc attaagtcgt ttgaacgaac cttgtattca gcgtttggtt
    8651  tcgacgaaga cctgcttgac gtgtggatgc aaggtgaata caccagcaac
    8701  gctacaactc tggacggtca actttctttt tccgtcgaca accagaggaa
    8751  atcgggcgct tctaatacgt ggattggtaa ttccatcgag actcttggta
    8801  ttttgagcat gttctattac accaatcgat ttaaggctct tttcgtgtcc
    8851  ggggacgact ctttgatttt ctccgaatct cctatcagaa attcagccga
    8901  tgcgatgtgc acagaactcg gttttgagac taagtttctc actccgagcg
    8951  tcccgtattt ctgctcaaag tttttcgtta tgaccggtca cgacgttttc
    9001  ttcgtgcccg acccttataa acttttagtg aaattaggag cttctaagga
    9051  tgaagtagac gatgagtttc tgtttgaagt gttcacctct tttcgcgatt
    9101  taacgaaaga tttagtcgat gaaagagtga tcgaactctt gacgcatttg
    9151  gttcacagta agtacgggta cgaaagtggt gatacgtacg ccgccctgtg
    9201  tgctattcat tgtattcgtt caaacttttc atcgttcaag aaattgtacc
    9251  ctaaagttaa gggttgggtc gttcactacg gtaaactgaa gtttgtgctg
    9301  cgcaaattcg cgaactgttt tcgcgagaag tttgacactg ctttcggcga
    9351  acgtactttc ttacttacga cgaagcttga aacggtgttg tgactcagtt
    9401  gctgttttgt ttatttgtgt gtctgtagtc ctactttgcg gttatggact
    9451  gtgtactccg ctcgtattta ttactcgcat tcggtttttt gatttgcttg
    9501  ttccttttct gcttggtggt cttcatttgg ttcgtgtata aacagatact
    9551  ttttcgaact accgcgcagt cgaacgaagc gcgtcacaac cattctacgg
    9601  tcgtgtgatg gttgttttcg gtttagactt cggcaccact ttttcaagtg
    9651  tgtgtgccta tgttggagaa gaactgtatc tgttcaagca gagagatagt
    9701  gcttacatac ctacttacgt atttttacat tctgatactc aagaagtggc
    9751  tttcggatac gacgccgagg ttctttctaa cgatctttca gttcgtggag
    9801  gtttctatcg cgacttaaaa cgctggatag gatgcgacga agaaaactat
    9851  agagactacc tggaaaaact taagccgcac tacaagacag agctgcttaa
    9901  ggttgctcaa agttcgaagt ccactgtgaa attggactgt tactctggta
    9951  ccgtgccaca gaatgccact ttaccaggtt tgatagcgac tttcgtcaaa
   10001  gctctgattt ccacagccag cgaagctttc aaatgtcagt gcaccggtgt
   10051  tatctgttca gtccctgcca actacaattg tttgcaaagg tcttttaccg
   10101  aaagttgtgt caatctgagt ggctacccct gtgtttacat ggttaacgag
   10151  ccgtcggctg cggcgctttc tgcttgttct agaatcaaag gcgccacttc
   10201  acccgttctc gtgtacgatt tcggaggtgg aacgtttgac gtttccgtga
   10251  tttcagcgct caacaacact tttgtggtgc gcgcttcggg aggtgacatg
   10301  aacttgggtg gtcgcgacat cgacaaggct tttgttgaac acttgtacaa
   10351  caaagctcaa ctgcccgtga actacaaaat tgatatttcc ttcttgaaag
   10401  agtcgctttc aaagaaggtt tctttcctga acttcccggt ggtcagtgaa
   10451  cagggcgtaa gagttgacgt tttagttaac gtcagcgagt tagctgaagt
   10501  ggcggccccg ttcgtggaga gaacgataaa aatagttaaa gaagtttacg
   10551  aaaagtactg tagcagtatg cgattggaac caaacgttaa agctaaattg
   10601  cttatggtgg gtgggtcttc ttacttgccc ggtctgctgt cacgtctttc
   10651  ctctataccg ttcgtggacg aatgcctcgt gctgcccgac gctcgagcgg
   10701  cggtcgccgg ggggtgcgct ttgtactcag cttgtcttcg aaacgattct
   10751  ccgatgttgt tggttgactg cgcagctcac aatctcagca ttagtagcaa
   10801  atattgtgaa tccatcgtat gtgttcctgc tggttcacct atcccgttta
   10851  cgggagttag aacggttaac atgaccggtt ctaacgcttc cgctgtctat
   10901  agtgcggcgc tttttgaagg ggacttcgtt aagtgtcgtc taaacaagag
   10951  gattttcttt ggcgatgtcg ttttaggaaa cgtcggggtg actggttccg
   11001  ctactaggac agtcccgcta acactcgaaa ttaacgtttc gagcgtcgga
   11051  acgatctctt tttctctcgt cggaccgacg ggtgttaaga aactaatagg
   11101  tggaaacgct gcttacgatt tctcgagtta tcagctcggg gagcgcgtcg
   11151  tcgctgactt gcacaaacat aattctgata aagtgaaact cattcatgct
   11201  ctgacatatc aaccttttca aaggaagaaa ttgactgacg gcgacaaagc
   11251  tctgttctta aagagactga ctgctgatta ccgacgtgaa gcaaggaagt
   11301  ttagttcgta tgacgacgcg gttctcaact ccagcgaatt actactgggg
   11351  agaattattc cgaagattct tcgggggtca agagtggaaa aacttgatgt
   11401  ctgaagctgc ttcggttagt cgacctaggt acagtagcga ctttcgtttt
   11451  tcagacggtg ttatattaag tcgcaagacg tttggcgaat caaccggcga
   11501  gtcattcgta cgcgagtttt ccttgttgct gacgttccca aagacttacg
   11551  aagtttgcaa attatgcggt gtggccatgg aactagctct gaatggtatg
   11601  aatcgtctgt ccgattataa tgtttcggag ttcaacattg tcgatgtgaa
   11651  aaccgtgggt tgcaagttta atatacagtc cgtcactgaa ttcgtgaaaa
   11701  agatcaacgg gaatgtggcc gaaccttctc tcgtcgagca ctgctggtct
   11751  ctgtctaatt cttgcggtga attgatcaat ccgaaagata cgaagcgatt
   11801  cgtctctctt atctttaaag ggaaagacct cgccgaaagt accgacgaag
   11851  ctatagtttc ctcttcttac ttagattacc tttcccattg tttgaactta
   11901  tatgaaacgt gtaatctttc atctaactcg gggaagaaat ctttgtacga
   11951  tgaatttcta aagcacgtga tcgattacct tgaaaacagc gacttagaat
   12001  atcgttcacc ttctgacaac cctttggttg ccggcattct ttacgatatg
   12051  tgttttgagt acaacacgct taagtcgaca tacttgaaga acatagagtc
   12101  tttcgattgt tttctaagtc tgtatttgcc gttgcttagt gaagtctttt
   12151  cgatgaactg ggaacgacca gcgcctgatg tcaggttgct tttcgaactc
   12201  gacgctgctg aacttctttt aaaagttccg acgattaaca tgcacgactc
   12251  aactttccta tacaagaata agttgaggta tttggagtcc tactttgaag
   12301  acgactctaa cgaacttata aaggtgaaag ttgactcact cttaacccga
   12351  gacaatcctg aactaaaact agcccagagg tgggtgggtt tccattgtta
   12401  ctacggggtc ttcaggaccg cccagactag gaaagtgaag agagacgcgg
   12451  aatacaaact tcctccggct ctcggtgaat tcgtaataaa tatgagtggg
   12501  gttgaagagt tctttgagga gctacagaag aaaatgcctt ccatttccgt
   12551  tcgccgcagg ttttgtggca gtttatctca cgaagctttt tctgttttca
   12601  aaagattcgg ggtgggtttc cctccgatca ctaggttaaa tgttccagtg
   12651  aagtactcct atctaaacgt tgattattac agacatgtaa agagggtagg
   12701  tttgacgcag gacgagttga ctattcttag taacatcgaa ttcgatgtcg
   12751  ctgaaatgtg ttgcgagagg gaagtggctt tacaagcccg tcgcgctcag
   12801  cgcggcgaaa aaccatttca gggttggaaa ggtacaaaaa acgaaatttc
   12851  tccgcacgcg cgttcttcaa ttcgagtgaa aaagaacaac gactctttac
   12901  taaacatttt gtggaaagat gttggcgccc gaagccagag gagacttaat
   12951  ccacttcacc gaaaacacta gagatgctat ggaaactttc ttcaacagct
   13001  acgatctagc tgaatattcc gaagtgaatc ctaacaaact taatcggaag
   13051  gaaaccgacg aactattggg cgttattcga gagaggttca aatccgaact
   13101  ggtgatcaca gatgaagatt ttgtgaagca cttagctttc gcgttgatcc
   13151  gcgccgctaa tatcacaact agtgtgaaag ttaactacgt cggagcatac
   13201  gaatatacga taggaggaaa gaagttcctg gtcaaggatg cttgggtttt
   13251  tcctctaata aaagagtgta tgaaaaagtt taataaacct aatcctgtga
   13301  ggacgttttg cgccactttc gaagacgctt acattgtgat agctcgttcg
   13351  ttacccaaac tgttcctgaa tagaaccatt ggcaaacgcg ggatcccgtc
   13401  ggggtacgaa ttcctcgggg cagattttct gaccgcaacc agtgtgtgtt
   13451  tgaacgatca cgaaaaagct atcgtattac aagcctcaag agctgccatt
   13501  gacagagctg tttcttcgtc ggtcgacggg aagatagtca gtcttttcga
   13551  cctcggtcgt cttagttaac acagttacta aggttccatt ttattacagt
   13601  attgtttttg ttttagcgta atcgtacttg agtttcgtta tgggatcagc
   13651  tgaacctatt agtgcaatcg cgacttttga aaacgtaagt ctcgcagacc
   13701  aaacctgttt gcacggagaa gactgcgata aacttaggaa gaacttcgaa
   13751  gagtgtttga aattaaaagg ggttccggaa gataacctcg gaatcgcgtt
   13801  aggactttgt ttgtattcct gtgctacgat aggcacttcc aacaaagtta
   13851  acgtccaacc gacgtctacc ttcatcaaag cttcgtttgg tggtgggaag
   13901  gaactgtacc tcactcacgg tgaattgaat tcctttctgg ggtctcaaaa
   13951  acttttggag ggaaaaccta acaaattgcg gtgtttctgc cgtacttttc
   14001  agaaggacta catatccttg cgcaaggaat accgagggaa attacctccg
   14051  attgccagag ctaaccgtca cggtctaccc gctgaagatc actacttagc
   14101  cgctgacttc atatcgacgt cgacggaact cactgaccta caacaaagtc
   14151  gtctgctgtt agcgcgcgaa aacgccactc acacggaatt ctcgtctgaa
   14201  tcaccggtaa ccagtttgaa acaactaggt cgtggtctag gcaccgggag
   14251  atgactagtt ctgtcgaact agctcagaca aaaccccttt ttagagtatt
   14301  gctattaaag ggctttgttt tttatgttgt tgcgttcgaa accgaagagg
   14351  aatcatcgga agctgaactt cctttggtat acctccacga tttcgaatta
   14401  aacattaaca agagagggaa aattgaagct tcatacgtcg actttatgtc
   14451  ttgtatgact aggttaaaac ctagttcggt ttcttatact cgagtgagtt
   14501  cagaaaaatc ttccgaagac ttttctttac caggctcggg aaagactttc
   14551  ggttctaaag ttcttaatcg taaagtgacg tttacgttcg aaaacggagt
   14601  ccaactagtg ttcgggatgt atggactcga acaacggtgc gtttcttccg
   14651  actacttgtg gtttgaaaac gttttcgttg gcgcgcactg cggcacctta
   14701  acctattgtc tgaattgcga attagacaaa agtggtggtg aattagagat
   14751  tttgaccttt tcgaaaaatg aagttcttct taaaagatgg tgaaacttct
   14801  cgagccttgt ctaggtctga atcgctccta cgtcgtgtga aggaactcgg
   14851  aacgaattcg caacaaagcg agatttccga atgcgtcgac gaattcaacg
   14901  aactggcgag ttttaatcac ttgttagtta cagttgaaca cagggaatgg
   14951  atggaacagc atccgaacca gtcgtcaaaa ctccgcgttc catcacgaat
   15001  tggtgaaatg cttaaagaga tacgcgcgtt ccttaaagta cgcgtggtaa
   15051  ctcctatgca caaggaaacc gccagcgata ctctgaatgc gtttctagaa
   15101  gagtactgcc gaattactgg actcgctcgt gaagacgctt tacgagaaaa
   15151  gatgagaaaa gtgaagagtg tggtactatt tcatcattcg gaacttttga
   15201  agttcgaagt gactgaaaac atgttcagct atactgaact actaaaactg
   15251  aatctaagct tgagggtaat ttcttctcaa atcctcggaa tggctatata
   15301  gagaagtgac ggaggcgacc tacctaccgt gtaatttaag tcgtcacaga
   15351  gtgacaacgg caccaagtgg tgcttagtgc gtatgtaaat tacgaagtgc
   15401  aaaaaatttt tctttttata ttaagaaaat ttttgcacac tcctagcgaa
   15451  gtcccgctag gaagaaaaaa taaggggccc