!!NA_SEQUENCE 1.0
ID   BNYVMTP2   standard; RNA; VRL; 1922 BP.
XX
AC   X75574;
XX
SV   X75574.1
XX
DT   01-JUN-1994 (Rel. 39, Created)
DT   01-AUG-1994 (Rel. 40, Last updated, Version 13)
XX
DE   Beet necrotic yellow vein mosaic virus (Yu2) genomic RNA for transport
DE   proteins
XX
KW   13K transport protein; 15K transport protein; 42K transport protein;
KW   transport protein.
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RX   MEDLINE; 94321971.
RA   Kruse M., Koenig R., Hoffmann A., Kaufmann A., Commandeur U.,
RA   Solovyev A.G., Savenkov I., Burgermeister W.;
RT   "Restriction fragment length polymorphism analysis of reverse
RT   transcrition-PCR products reveals the existence of two major strain groups
RT   of beet necrotic yellow vein virus";
RL   J. Gen. Virol. 75:1835-1842(1994).
XX
RN   [2]
RP   1-1922
RA   Solovyev A.;
RT   ;
RL   Submitted (02-NOV-1993) to the EMBL/GenBank/DDBJ databases.
RL   Solovyev A., Institute for Biochemistry and Plant Virology, Messeweg 11/12,
RL   Braunschweig, Germany.
XX
DR   SPTREMBL; Q65683; Q65683.
DR   SPTREMBL; Q65684; Q65684.
DR   SPTREMBL; Q65685; Q65685.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1922
FT                   /db_xref="taxon:31721"
FT                   /organism="Beet necrotic yellow vein virus"
FT   CDS             1. .1155
FT                   /db_xref="SPTREMBL:Q65683"
FT                   /product="42K transport protein"
FT                   /protein_id="CAA53250.1"
FT                   /translation="MVQVQRRTGGDKGAKGNRASSAPVRSRRMTQDDWSRTHPDDIFSV
FT                   IEKTLVEDGYKWNGVKPGHCDWGKLKESGAVDNFRGTLEGELGKNCDLTCNAAAVKLDT
FT                   LQKVKMSSDWTARVGIVLGAPGVGKSTSIKNLLDKFGAKHKMVLCLPFSQLLEGVFAGR
FT                   LDTFLVDDLFCRSVEYGKYNTMLVDEVTRVHMCEILVLAGHLGVKNVICFGDPAQGLNY
FT                   KAGSAVNYNFPIIAECYASRRFGKATADLINSSNGGGKPVVGNNEVKDSWTFEELCGKI
FT                   LDMSTVLVATRETQKFLLEDNIESILYSDAHGQTYDVVTIILEDEFDDAAICDPNVRAV
FT                   FLTRARKGGMIKMGPNIAARFKNGDFNSRGVSKSCTGDTFCEDR"
FT   CDS             1155. .1511
FT                   /db_xref="SPTREMBL:Q65684"
FT                   /product="13K transport protein"
FT                   /protein_id="CAA53251.1"
FT                   /translation="MSREITARPNKNVPIVVGVCVVAFFVLLAFMQQKHKTHAGGDYGV
FT                   PTFSNGGKYRDGTRSADFNSNNHRAYGCGGSGGSVSSRVGQQLVVLAIVSVVIVLLLQR
FT                   LRSPPEHICNGACG"
FT   CDS             1495. .1893
FT                   /db_xref="SPTREMBL:Q65685"
FT                   /product="42K transport protein"
FT                   /protein_id="CAA53252.1"
FT                   /translation="MVLVVKVDLSNIVLYIVAGCVVVSMLYSPFFSNDVKASSYAGAVF
FT                   KGSGCIMDRNSFAQFGSCDIPKHVAESITKVATKEHDADIMVKRGDVTVRVVTLTETIF
FT                   IILSRLFGLAVFLFMICLMSIVWFWCHR"
XX
SQ   Sequence 1922 BP; 505 A; 309 C; 509 G; 599 T; 0 other;

X75574  Length: 1922  December 21, 2001 16:02  Type: N  Check: 7433  ..
       1  atggtccaag tacagcgtag aacgggcggc gacaagggcg caaagggcaa
      51  tcgtgcttcc agcgcccccg tccgctcccg ccggatgact caggatgact
     101  ggtcacgtac ccatcccgac gatattttct cagttattga gaaaacacta
     151  gtagaggatg ggtataaatg gaacggggta aaacccggac attgcgattg
     201  gggcaaattg aaggaatctg gtgctgttga taattttagg ggtacattag
     251  aaggcgagtt aggtaaaaat tgtgatttaa cttgtaatgc tgctgccgtt
     301  aaacttgaca cattgcaaaa ggtgaaaatg tcatcagatt ggactgccag
     351  agttggtatt gttttgggtg ctcctggtgt tgggaaatct acctcgatta
     401  agaacttatt agacaaattt ggagcaaaac ataaaatggt gttatgctta
     451  cctttcagtc agttgttaga aggagtgttt gctggtcggt tggacacttt
     501  tctggttgat gatttgttct gtaggtccgt ggaatatgga aaatacaaca
     551  ccatgcttgt agatgaggtc actcgtgtgc atatgtgtga gattttggta
     601  cttgccggac atttaggtgt taagaacgtg atatgttttg gtgatccggc
     651  gcaagggtta aattataagg ccggttctgc cgtgaactat aattttccga
     701  ttattgctga atgttatgct agtagacggt tcggtaaggc gactgccgat
     751  ctcattaatt ccagcaatgg tggtggtaaa cctgtagtcg gtaataacga
     801  ggtaaaggat agttggactt ttgaagaact atgtgggaag atactagata
     851  tgtctactgt tttggtagca acacgcgaaa cccaaaagtt tctattagaa
     901  gataatattg agtctattct ttactcggac gcccacgggc aaacatacga
     951  cgttgtcact atcattttgg aagacgagtt tgatgatgct gccatttgcg
    1001  acccaaatgt tagggctgtc tttttaacga gagctcgtaa gggtggtatg
    1051  attaaaatgg gtcctaacat cgctgccagg ttcaaaaacg gtgattttaa
    1101  ttcacgtgga gttagtaagt cttgcaccgg agatactttt tgcgaagata
    1151  gataatgtct agggaaataa ccgcccgacc caataagaat gtgcctattg
    1201  ttgttggtgt ttgtgttgtg gctttctttg tattgctggc gttcatgcag
    1251  caaaaacata agacacatgc tgggggcgat tacggagttc caacattttc
    1301  taacggtggt aaatatagag acggtacaag gtcagctgat tttaatagta
    1351  ataatcatcg tgcttacggg tgcggtgggt ctgggggtag cgttagtagt
    1401  cgagtcgggc agcaacttgt tgtgttagct attgtgtctg tggtaatagt
    1451  attactgtta caacgattaa gatctccacc agaacatatt tgtaatggtg
    1501  cttgtggtta aagtagattt atccaatatt gtgttgtata tagttgccgg
    1551  ttgtgttgtt gttagcatgt tgtactcacc atttttcagc aacgatgtta
    1601  aagcgtccag ctatgcggga gcagttttta aagggagtgg ctgtatcatg
    1651  gacaggaatt cgtttgctca atttgggagt tgcgatattc caaagcatgt
    1701  agccgagtcc atcactaagg ttgctaccaa agagcacgat gctgatataa
    1751  tggtaaaaag aggtgacgtg accgttcgtg ttgtgactct caccgaaact
    1801  attttcataa tattatctag attgtttggt ttggcggtgt ttttgttcat
    1851  gatatgttta atgtctatag tttggttttg gtgtcataga taaattgtgg
    1901  tggaatgagt atggggatgg ta