!!NA_SEQUENCE 1.0
ID   BAMMVRNA2  standard; RNA; VRL; 3524 BP.
XX
AC   X75933;
XX
SV   X75933.1
XX
DT   11-NOV-1994 (Rel. 41, Created)
DT   10-FEB-1999 (Rel. 58, Last updated, Version 3)
XX
DE   Barley mild mosaic virus complete sequence of RNA2
XX
KW   RNA2.
XX
OS   Barley mild mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Bymovirus.
XX
RN   [1]
RA   Timpe U., Kuehne T.;
RT   "The complete nucleotide sequence of RNA2 of barley mild mosaic virus
RT   (BaMMV)";
RL   Eur. J. Plant Pathol. 100:233-241(1994).
XX
RN   [2]
RP   1-3524
RA   Timpe U.;
RT   ;
RL   Submitted (20-DEC-1993) to the EMBL/GenBank/DDBJ databases.
RL   U. Timpe, Bundesanstalt. fuer Zuchtungsforschung, Inst. f.
RL   Resistensforschung, Theodor-Roemer-Weg 4, D- 06449 Aschersleben, FRG
XX
DR   SWISS-PROT; Q65329; POL2_BAMMA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3524
FT                   /db_xref="taxon:12466"
FT                   /organism="Barley mild mosaic virus"
FT                   /isolate="ASL"
FT                   /clone="pG12, pG2708, pG3728, pG5'"
FT   CDS             141. .2822
FT                   /db_xref="SWISS-PROT:Q65329"
FT                   /note="ORF"
FT                   /protein_id="CAA53537.1"
FT                   /translation="MMMNSMIRQGWQQVLRRFSIPTSGDRLIVSNSTDQPIGLFGAFDT
FT                   SLQTLSQVTNDPEVLKQKSNIPTHLDVASVLEASPRSFPWVFLTNSFCTFGGSIHAQNL
FT                   QAFATAEFKSGFCYMNLLIPLSFDIIDAHADSFRGFVEQLPDTLGAYPSLSMVLNVMLH
FT                   AATRFPEIVASPIPTIAFDAESLQFHVTDKRGVPGMWNILKACRVYELLSLAADGIGCE
FT                   YMLYPVGAAPQYSFWKKSMDHFTSDRFVEFLAMQDLLASALEQDYATHDARDALLSALQ
FT                   NAGYTNVVARERRFPNGHDPSIVWLNLSEAPISEKLTELKRYLLVGHRSDDTADITHNV
FT                   HQHVFEVLKTMSVQFSKTTNAYNRARFEVNHKVIWNAEYGRGPQQNAELEALVLFLNRQ
FT                   SLEIENILHRTTSPVVVTSWKPDVPPAAPEIKEEEPTHAIATPITEAPSHVTPVEVVNL
FT                   PPTRSYWAETLVGILTAILGTVFAFLTRALIRAKRLRRKSTFPWVTLNSGDDDDDQSGG
FT                   GGGGPQTPGGQPPVPHTRGTHQSRFSVQDIASDTSLLSVDLDEDTLSQYDETFQKIRRA
FT                   LFETSFADILQNSARWISTLEAMALADGNAPYTLLAQYLNGIEEAYTNFRNTGHISRAT
FT                   LSGFFALEDNLRAAGIAFGTTTPTQTIQNQFADSPARRWKTRFEQIACELGDASIKSLA
FT                   DLADIIDTERERGDLTQFDVLAASSISSLCRAVRIISDTTDPNAQLALVENATAMQNNI
FT                   NAILGTNVSIPFLSATRRLLITRRVQEAGAESRSGATPETVQQLADAELAKIVSEANMY
FT                   NEMAASQRDIANATREATIREHVLSPVNALANVGMAAAFFRSGGLRSRAFNPAMPTMPG
FT                   GPAAAGRPMFQAFRGRGHRLNR"
FT   polyA_signal    3505. .3509
FT                   /note="putative"
XX
SQ   Sequence 3524 BP; 901 A; 1029 C; 797 G; 797 T; 0 other;

X75933  Length: 3524  December 21, 2001 16:02  Type: N  Check: 1969  ..
       1  aaaataaaac ttcacaaaaa cccaacgact taaaacgaac acaattaagc
      51  aaacaaacaa acaccaaacg cacacaacga attacagcac acagctgtaa
     101  agcgcgaact cattcaccgc aatctttgca ttgagccaag atgatgatga
     151  actccatgat ccgccaagga tggcagcagg tgctgaggcg cttttccatc
     201  ccaacatccg gagatagact catcgtttcc aactccaccg accaacccat
     251  cggccttttc ggagcgttcg acacatcgct gcaaacactc tcacaagtca
     301  ccaatgatcc tgaggtcttg aagcagaagt ccaacatccc cacgcacctg
     351  gacgtggcct ccgttcttga agcaagccca cggtccttcc catgggtttt
     401  tctcacgaac tcattctgca ccttcggtgg ttcgatacat gctcagaatc
     451  ttcaagcctt cgcaactgcc gagtttaaga gcgggttctg ttacatgaac
     501  ctgctaatac cactcagctt tgatatcatc gacgcacacg cagattcttt
     551  tcgcggcttt gttgaacaac ttcctgacac gttaggcgcc tacccttcac
     601  tcagcatggt gctaaacgtc atgttgcacg cagccacgcg tttccccgag
     651  atcgtcgcct cccctatccc aaccatagca tttgacgccg aatcactgca
     701  gttccatgtt actgataaac ggggtgtccc tggcatgtgg aacatactca
     751  aagcctgccg tgtgtacgag cttctttcgc ttgcagcaga tggtataggt
     801  tgcgagtaca tgctgtaccc tgttggtgct gcaccccaat actccttctg
     851  gaagaaatcc atggaccact tcacatccga ccggttcgtg gaattcctag
     901  ccatgcagga tctgctcgcc agtgcacttg aacaagatta tgcaacacat
     951  gacgcgcgcg atgcactact ttcagctctc cagaacgcag gttacacaaa
    1001  cgttgttgca agggagagga ggtttccaaa tggccacgac cctagcattg
    1051  tctggttgaa cctgagcgaa gcccccattt cagagaagct aactgaactt
    1101  aaacggtacc tcctagtcgg acataggagc gacgacactg ctgatatcac
    1151  acacaacgtg caccagcacg tttttgaagt cctcaagacc atgtctgtgc
    1201  agtttagcaa gacaacgaac gcctacaacc gtgcccgctt tgaagtcaac
    1251  cacaaagtca tatggaacgc agaatacgga cgcggccctc aacagaacgc
    1301  cgagctcgag gctcttgtac tctttcttaa taggcaatcg cttgaaattg
    1351  agaacatctt gcacagaaca actagtcctg ttgttgtcac cagctggaaa
    1401  cccgatgttc cccctgctgc acctgaaatc aaagaggagg aacccacgca
    1451  cgcaatcgca acaccaataa ctgaggcgcc atcacatgtc actcctgttg
    1501  aagttgtgaa cctgccacca acgcgctcct attgggctga gacacttgtc
    1551  ggtatcctca ctgcaatcct gggaacggta ttcgccttcc tcactcgagc
    1601  actcattcgt gcaaagagat tgcggaggaa atccaccttc ccctgggtga
    1651  cgctaaactc tggagatgac gatgatgacc aatctggggg gggaggaggt
    1701  ggcccgcaaa cacctggcgg gcagccccca gtcccgcaca cgcgtggaac
    1751  gcaccagtcg cgcttctccg tgcaggacat agcatccgac accagtctgc
    1801  taagtgtcga tctcgacgag gacacgctct cccagtatga tgaaaccttc
    1851  caaaagatcc gccgtgcgct cttcgaaacc agttttgcag acatcctgca
    1901  aaactctgct cgttggatct ccacgctgga agcgatggct ctcgcagatg
    1951  gcaatgctcc ttacacactt cttgcgcagt atctcaacgg gattgaggag
    2001  gcatacacga actttcgcaa cacaggtcac atctcccgcg caacactttc
    2051  aggcttcttc gccttggaag ataatctgcg tgcagctggc atagcttttg
    2101  ggaccacaac acccacgcaa accatacaga accaatttgc cgactcccca
    2151  gcccgtcgat ggaaaacacg atttgaacag attgcatgtg aactgggcga
    2201  tgctagcatc aaatcgcttg cagatcttgc agacatcatc gacactgagc
    2251  gggagagggg cgacttgact cagtttgatg ttctcgcagc ctcttccatc
    2301  agcagcctct gtcgtgctgt gcgcatcatc agtgacacca ccgatccaaa
    2351  tgctcaatta gcccttgttg aaaacgcaac ggctatgcag aacaacatca
    2401  acgccatact gggcacgaac gttagcatac ctttcctcag tgcgacgcgt
    2451  cgtttactca tcacacgccg tgttcaagaa gccggggcgg agagccgctc
    2501  tggagcaacg cctgaaaccg ttcagcaact ggctgacgca gagctggcaa
    2551  aaattgtgag cgaggcaaac atgtacaatg agatggccgc cagccaaagg
    2601  gacatcgcca acgcaacacg cgaagccacc atccgcgagc acgtgctcag
    2651  ccccgtcaac gctttggcaa atgttggcat ggctgctgcg ttcttccgat
    2701  ccggtggttt gcgctcaagg gccttcaacc ccgcaatgcc aacaatgccc
    2751  ggtggtcctg ctgctgcggg gcggccaatg ttccaagcct tcaggggacg
    2801  agggcatcgt cttaataggt aggcatcaga actctgtgct ctggcacagc
    2851  actgaacgag cgacacgcgc tcgttgtgaa gatccaattc cacgcccagc
    2901  gtgccactga acaaacgaaa cacgtttgtt gtgataatta attaattttt
    2951  gcgcagactt tgtctgtgtt ttctagagtg tgctgctctg cagctgcatt
    3001  ggagggtttc acgggaacga catcatcaca ccccatccgc aaaccgcctg
    3051  cattcacatc tttgtgccac tttaaatact catacgcata ggcaagtgcc
    3101  tttctggcag agcatccccg agcatcgaca ttcacgcgat tgcaatcaac
    3151  tggcttaatc cccggttttg caatcaatag tgagttctac ctccggacgt
    3201  gttcccctgg aactgcaatc ctcgttatgt tgtcgctgat tactatcagc
    3251  tcgtaaacca tgatatccac ccacaatcag ctactcgtgt actaacagta
    3301  ccggacacgc ctatcctgca cttaagcctg caggacgcta ccaggtccgc
    3351  ctactgttac catttgtgta gtttgttgtg gctccacctc atatctaaat
    3401  tcagtacctg catacaaaac gtcatgcatc cctgttcaac atgagcacgg
    3451  tttgggaaga agcaagtcat catagactgc tggcattgtt aggttgacaa
    3501  tgtttatgta cacaggaacg tgac