!!NA_SEQUENCE 1.0
ID   BMMVP1P2   standard; RNA; VRL; 2428 BP.
XX
AC   X82625;
XX
SV   X82625.1
XX
DT   20-APR-1995 (Rel. 43, Created)
DT   20-APR-1995 (Rel. 43, Last updated, Version 3)
XX
DE   Barley mild mosaic virus mRNA for RNA2 polyprotein
XX
KW   p1 protein; P2 protein.
XX
OS   Barley mild mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Bymovirus.
XX
RN   [1]
RX   MEDLINE; 95225749.
RA   Dessens J.T., Nguyen M., Meyer M.;
RT   "Primary structure and sequence analysis of a mechanically transmitted
RT   barely mild mosaic virus isolate: an evolutionary relationship between
RT   bymo- and furoviruses";
RL   Arch. Virol. 140:325-333(1995).
XX
RN   [2]
RP   1-2428
RA   Dessens J.T.;
RT   ;
RL   Submitted (08-NOV-1994) to the EMBL/GenBank/DDBJ databases.
RL   J.T. Dessens, INRA, Station de Pathologie Vegetale, Route de St Cyr, 78026
RL   Versailles, FRANCE
XX
DR   SPTREMBL; Q65655; Q65655.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2428
FT                   /db_xref="taxon:12466"
FT                   /organism="Barley mild mosaic virus"
FT                   /sub_species="RNA2 deletion mutant"
FT                   /strain="Reims-M"
FT   5'UTR           1. .139
FT   CDS             140. .1732
FT                   /db_xref="SPTREMBL:Q65655"
FT                   /product="RNA2 polyprotein"
FT                   /protein_id="CAA57945.1"
FT                   /translation="MMMNSTIRQGWQQVLRRFSIPASGDRLIVSNSTDQPIGLFGRFDA
FT                   SLQTLSQVTNDPEILKQKSNIPTHLDIASVLETSPRSFPWVFLTNSFCTFGGSRHAQNL
FT                   QAFATAEFKSGFCYMNLLIPLSFDIIDAHADSFRSFVEQLPDTLGSYPSLSMVLNVMLH
FT                   AATRFPEIVASPVPTIAFDAESLQFHVTDKRGVPSMWNILKACRVHELLSLAADGIGCE
FT                   YMLYPVGAAPQYSFWKKSMDHFISDRFVEFLAMLVLLASALEQDYKTHDARDALLTALQ
FT                   NAGYTNVVARERRFPNGHDPSTVWLNLNEAPISEKLAELKRYLLVGHRSDEIADITHNV
FT                   NQHVFEVLKTMSVQFSKTTNAYNRARFEVNHKVMWNAECGRSSQQNAELKALVLFLNRQ
FT                   SLEIKNILRRTTSPVVVTNWQPDVPPAAPEISEGESTHAVATPITEAPTHATPIEVVNL
FT                   PPTRSYWAETLVGVLTAILGTIFALLTRALIRAKRLRRKSTFPWVSIDSGDEDDDHSGG
FT                   GGGSPQTHRLNRR"
FT   mat_peptide     140. .826
FT                   /gene="P1"
FT                   /product="P1, putative proteinase"
FT   mat_peptide     827. .1729
FT                   /gene="P2"
FT                   /product="P2, putative transmission protein"
FT   misc_feature    1711. .1712
FT                   /note="deletion, approximately 1000 nt"
FT                   /gene="P2"
FT   3'UTR           1730. .2428
XX
SQ   Sequence 2428 BP; 645 A; 666 C; 512 G; 605 T; 0 other;

X82625  Length: 2428  December 21, 2001 16:03  Type: N  Check: 8351  ..
       1  aaaataaaac tacacaaaaa cccaacgatc taaaacgatc actatcaaac
      51  agcaaacaca caacaagcaa acacaacaga ttgcagcgca cagttctgaa
     101  acacgaactc atccactgca gttttggaat ccgatcgcga tgatgatgaa
     151  ctctacgatt cgccaaggat ggcagcaagt gctcaggcgt ttttccatcc
     201  cagcatccgg agatagactc atcgtctcca attccactga ccagcccata
     251  ggtcttttcg gacgatttga tgcatcactc caaacactct cacaagtcac
     301  caatgaccct gagattttga agcagaagtc caacatcccc acgcatctag
     351  acatagcatc tgtgctcgaa accagccctc gatcttttcc atgggttttc
     401  ctcacaaact ccttctgcac tttcggtggc tccagacacg ctcagaacct
     451  tcaagccttt gcaaccgccg agttcaagag tggcttttgt tacatgaacc
     501  tgctgatacc gcttagcttc gacatcatcg atgcacacgc cgattccttc
     551  cgcagttttg tcgaacaact ccctgacacg ctaggttcct atccttcgct
     601  cagcatggta ctaaacgtca tgttgcacgc agccacgcgc ttcccagaga
     651  ttgtcgcttc ccccgttcca actatagcat tcgatgctga atcactgcaa
     701  tttcatgtaa ctgataaacg gggcgtccct agcatgtgga acatacttaa
     751  ggcctgccgc gtgcatgagc tcctctcgct tgctgcggat ggcataggct
     801  gcgagtacat gctgtatccc gttggtgctg cgccccaata ctccttctgg
     851  aagaaatcca tggaccactt catatctgac cggtttgtgg aattcttagc
     901  catgctggtt ttgcttgcta gtgcacttga gcaggattac aaaacacacg
     951  acgcacgcga tgcattactc acagctctac agaacgcagg ttacacgaat
    1001  gttgtcgcaa gagaacggag atttccaaac ggccatgatc caagcaccgt
    1051  ctggttgaac ctgaacgagg ctcccatttc agagaagcta gctgagctta
    1101  aacgatacct cctggttggt cacagaagcg atgaaattgc ggacatcaca
    1151  cacaacgtta accagcacgt cttcgaggtt cttaaaacca tgtctgtgca
    1201  gtttagcaag acaaccaacg cttacaaccg cgcccgtttt gaggttaacc
    1251  ataaggtgat gtggaatgca gagtgcggac gcagttctca acaaaacgct
    1301  gagctcaaag cccttgttct atttctcaat agacagtcgc tagagatcaa
    1351  aaacattctg cgcagaacaa ctagtcccgt tgttgtgacg aactggcagc
    1401  ctgatgttcc tcccgcagca cctgaaatca gcgaagggga atcaacgcat
    1451  gcagtcgcaa caccaataac tgaggcacca acacatgcaa ctcctattga
    1501  agttgtgaat ttgccaccaa cacgctctta ttgggccgaa acactcgttg
    1551  gtgtgttaac cgcaattttg ggaaccatct tcgccttgct cactcgggcg
    1601  ctcattcgcg caaagaggct gcggagaaaa tccacctttc cttgggtgtc
    1651  aatagactct ggagacgaag atgatgacca ttctggtgga ggaggaggta
    1701  gcccacaaac acaccgtctc aatagacgtt aaaactctgt gctttggcac
    1751  agcactgaac aagcgacacg cgcttgttgt gataattgat tccacgctta
    1801  gcgtaccact gaacaaacga cacacgtttg ttgtgataat taattaattt
    1851  ttgcgcagac tctgtctgtg ttttctagag tgtgctgctc ggcagctgca
    1901  tcggagggtt ttacgggaac gacatcatca caccccatcc acaaaccgcc
    1951  tgcattcaca tctttgtgcc actttaaata ctcatacgca taggcaagtg
    2001  cctttctggc agagcatccc ctggcatcga cactcacgcg atcgcaatca
    2051  actgacttaa tcctcggttt tgcaatcata tagtgagttc tacccctgga
    2101  cgtgttcccc tggaactgca atcctcgtta tgttgtcgct gattactatc
    2151  agctcgtaaa ccatgatatc cacccacaat tagctattcg tgtactagca
    2201  tcaccggata cgcctatcct gcacttaatc ctgcaggacg ctatcaggtc
    2251  cgctgactgt taccatttgt gtagctcgtt gtggttccgc ctcatatcta
    2301  aattcagtac ctgcatacaa aacgtcatgc atccctgttc aacatgagca
    2351  cgggtttggg aagaagcaag tcatcataga ctgctggcat tgttaggttg
    2401  acaatgttta tgtacacagg aacgtgac