!!NA_SEQUENCE 1.0
ID   BMMVRNA2A  standard; RNA; VRL; 2428 BP.
XX
AC   X84802;
XX
SV   X84802.1
XX
DT   24-JUL-1995 (Rel. 44, Created)
DT   24-JUL-1995 (Rel. 44, Last updated, Version 2)
XX
DE   Barley mild mosaic virus RNA 2 complete sequence
XX
KW   polyprotein.
XX
OS   Barley mild mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Bymovirus.
XX
RN   [1]
RX   MEDLINE; 96059522.
RA   Jacobi V., Peerenboom E., Schenk P.M., Antoniw J.F., Steinbiss H.H.,
RA   Adams M.J.;
RT   "Cloning and sequence analysis of RNA-2 of a mechanically-transmitted uk
RT   isolate of barley mild mosaic bymovirus bammv";
RL   Virus Res. 37:99-111(1995).
XX
RN   [2]
RP   1-2428
RA   Antoniw J.F.;
RT   ;
RL   Submitted (16-FEB-1995) to the EMBL/GenBank/DDBJ databases.
RL   J.F. Antoniw, IACR-Rothamstead, Plant Pathology Dept., Rothamstead
RL   Experimental Station, Harpenden, Herts AL5 2Q, UK
XX
DR   SPTREMBL; Q65656; Q65656.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2428
FT                   /db_xref="taxon:12466"
FT                   /organism="Barley mild mosaic virus"
FT                   /specific_host="Barley"
FT   CDS             140. .1732
FT                   /db_xref="SPTREMBL:Q65656"
FT                   /note="polyprotein"
FT                   /protein_id="CAA59269.1"
FT                   /translation="MMMNSTIRQGWQQVLRRFSIPASGDRLIVSNSTDQPIGLFGAFDA
FT                   SLQTLSQVTNDPEILKQKSNIPTHLDIASVLETSPRSFPWVFLTNFFCTFGGSRHAQNL
FT                   QAFATAEFKSGFCYMNLLIPLSFDIIDAHADSFRSFVEQLPDTLGAYPSLSMVLNVMLH
FT                   AATRFPEIVASPVPTIAFDAESLQFHVTDKRGVPSMWNILKACRVHELLSLAADGIGCE
FT                   YMLYPVGAAPQYSFWKKSMDHFISDRFVEFLAMQVLLASALEQDYKTHDARDALLTALQ
FT                   SAGYTNVVARERRFPNGHDPSTVWLNLNEAPISEKLTELKRYLLVGHRSDEIADITHNV
FT                   HQHVFEVFKTMSVQFSKTTNAYNRARFEVNHKVMWNAEYGRSSQQNAELKALVLFLNRQ
FT                   SLEIENILRRTTSPVVVTNWQPDVLPAAPEISEGESTHAVATPITKAPTHATPIEVINL
FT                   PPTRSYWAETLVGVLTAILGNIFALLTRALIRAKRLRRKSTFPWVLIDSGDEDDDHSGG
FT                   GGGSPQTHRLNRR"
FT   polyA_site      2428
XX
SQ   Sequence 2428 BP; 655 A; 664 C; 509 G; 600 T; 0 other;

X84802  Length: 2428  December 21, 2001 16:03  Type: N  Check: 6485  ..
       1  aaaataaaac tacacaaaaa cccaacgatc taaaacgatc attatcaaac
      51  agcaaacaca caacaagcaa acacaacaga ttgcagcgca caattctgaa
     101  acacgaactc atccactgca gtcttggaat ccgatcacga tgatgatgaa
     151  ctctacgatt cgccaaggat ggcagcaagt gctcaggcgt ttttccatcc
     201  cagcatccgg agatagactc atcgtctcca attccactga ccagcccata
     251  ggtcttttcg gagcatttga tgcatcactc caaacactct cacaagtcac
     301  caatgaccct gaaattttga agcagaagtc caacatcccc acgcacctag
     351  atatagcatc tgtgctcgaa accagccctc gatcttttcc atgggttttc
     401  ctcacaaatt tcttctgcac tttcggtggc tccagacacg ctcagaacct
     451  tcaagccttt gcaaccgccg agttcaagag tggattttgt tacatgaacc
     501  tgctgatacc gcttagcttc gacatcatcg atgcacacgc cgattccttc
     551  cgcagttttg tcgaacaact ccctgacacg ctaggtgcct atccttcact
     601  cagcatggta ctaaacgtca tgttgcacgc agccacgcgc ttcccagaga
     651  ttgtcgcttc ccccgttcca actatagcat tcgatgctga atcactgcaa
     701  tttcatgtga ctgataaacg gggcgtccct agcatgtgga acatacttaa
     751  ggcctgccgc gtgcatgagc tcctctcgct tgctgcggat ggcataggct
     801  gcgagtacat gctgtatccc gttggtgctg cgccccaata ctccttctgg
     851  aagaaatcca tggaccactt catatctgac cggtttgtgg aattcttagc
     901  catgcaggtt ttgcttgcta gtgcacttga gcaggattac aaaacacacg
     951  acgcacgcga tgcattactc acagctctac agagcgcagg ttacacgaat
    1001  gttgtcgcaa gagaacggag atttccaaac ggccatgatc caagcaccgt
    1051  ctggttgaac ctgaacgagg ctcccatttc agagaagcta actgagctta
    1101  aacgatacct cctggttggt cacagaagcg atgagattgc ggacatcaca
    1151  cacaacgttc accagcacgt cttcgaggtt tttaaaacca tgtctgtaca
    1201  gtttagcaag acaaccaacg cttacaaccg cgcccgtttt gaggttaacc
    1251  ataaggtgat gtggaatgca gagtacggac gcagttctca acaaaacgct
    1301  gagctcaaag cccttgttct atttctcaat agacagtcgc tagagatcga
    1351  aaacattctg cgcagaacaa ctagtcccgt tgttgtgacg aactggcagc
    1401  ctgatgttct tcccgcagca cctgaaatca gcgaagggga atcaacgcat
    1451  gcagtcgcaa caccaataac taaggcacca acacatgcaa ctcctattga
    1501  agttataaat ttgccaccaa cacgctctta ttgggccgaa acactcgttg
    1551  gtgtgttaac cgcaattttg ggaaacatct tcgccttgct cactcgggcg
    1601  ctcattcgcg caaagaggct gcggagaaaa tccacctttc cctgggtgtt
    1651  aatagactct ggagacgaag atgatgacca ttctggtgga ggaggaggta
    1701  gcccacaaac acaccgtctc aatagacgtt aaaaccctgt gctttggcac
    1751  agcactgaac aagcgacacg cgcttgttgt gataattgat tccacgctta
    1801  gcgtaccact gaacaaacga cacacgtttg ttgtgataat taattaattt
    1851  ttgcgcagac tctgtctgtg ttttctagag tgtgctgctc ggcagctgca
    1901  tcggagagtt ttacgggaac gacatcatca caccccatcc acaaaccgcc
    1951  tgcattcaca tctttgtgcc actttaaata ctcatacgca taggcaagtg
    2001  cctttccggc agagcatccc ctgcgacagc aacgcacgcg atcgcaatca
    2051  actgacttaa tcctcggttt tgcaatcata tagtgagttc tacccctgga
    2101  cgtgttcccc tggaactgca atcctcgtta tgttgtcgct gattactatc
    2151  agctcgtaaa ccatgatatc cacccacaat tagctactcg tgtactagca
    2201  tcaccggata cgcctatcct gcacttaagc ctgcaggacg ctatcaggtc
    2251  cgctgactgt taccatttgt gtagctcgtt gtggttccgc cgcatatcta
    2301  aattcagtac ctgcatacaa aacgtcatgc atccctgttc aacatgagca
    2351  cgggtttggg aagaagcaag tcatcataga ctgctggcat tgttaggttg
    2401  acaatgttta tgtacacagg aacgtgac