!!NA_SEQUENCE 1.0
ID   BMMVRNA2P  standard; RNA; VRL; 3524 BP.
XX
AC   X90904;
XX
SV   X90904.1
XX
DT   06-JAN-1996 (Rel. 46, Created)
DT   13-DEC-1996 (Rel. 50, Last updated, Version 4)
XX
DE   Barley mild mosaic virus complete sequence of RNA2 of fungally transmitted
DE   UK isolate
XX
KW   complete sequence; RNA2 polyprotein.
XX
OS   Barley mild mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Bymovirus.
XX
RN   [1]
RA   Peerenboom E., Jacobi V., Antoniw J.F., Schlichter U., Cartwright E.,
RA   Steinbiss H.H., Adams M.J.;
RT   "The complete nucleotide sequence of RNA-2 of a fungally-transmitted UK
RT   isolate of barley mild mosaic bymovirus and identification of amino acid
RT   combinations possibly involved in fungus transmission.";
RL   Virus Res. 40:149-159(1996).
XX
RN   [2]
RP   1-3524
RA   Antoniw J.F.;
RT   ;
RL   Submitted (17-AUG-1995) to the EMBL/GenBank/DDBJ databases.
RL   J.F. Antoniw, IACR-ROTHAMSTED, Plant Pathology Department, Harpenden,
RL   Herts, AL5 2JQ, UK
XX
DR   SWISS-PROT; Q65657; POL2_BAMMU.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3524
FT                   /db_xref="taxon:12466"
FT                   /organism="Barley mild mosaic virus"
FT                   /strain="UK-F"
FT                   /specific_host="barley"
FT                   /clone="pC6"
FT   CDS             143. .2827
FT                   /db_xref="SWISS-PROT:Q65657"
FT                   /gene="RNA2"
FT                   /product="RNA2 polyprotein"
FT                   /protein_id="CAA62412.1"
FT                   /translation="MMMNSTIRQGWQQVLRRFSIPASGDRLIVSNSTDQPIGLFGAFDT
FT                   SLQTLSQVTNDPEILKQKSNIPTHLDIASVLETSPRSFPWVFLTNSFCTFGGSIHAQNL
FT                   QAFATAEFKSGFCYMNLLIPLSFDIIDAHADSFRGFVEQLPDTLGAYPSLSMVLNVMLH
FT                   AATRFPEIVASPVPTIAFDAESLQFHVTDKRGVPGMWNILKACRVYELLSLAADGIGCE
FT                   YMLYPVGAAPQYSFWKKSMDHFISDRFVEFLAMQGLLASALEQDYKTHDARDALLTALQ
FT                   NAGYTNVVARERRFPNGHDPSTVWLNLNEAPISEKLTELKRYLLVGHRSDEIADITHNV
FT                   HQHVFEVLKTMSVQFSKTTNAYNRARFEVNHEVIWNAEYGRSSQQNAELEALVLFLNRQ
FT                   SLEIENILRRTTSPVVVTNWQPDVPPAAPEISEGEPTHAVATPITEAPTHATPVEVVNL
FT                   PPTRSYWAETLVGVLTAILGTIFALLTRALIRPKRLRRKSTFPWVSLDSGDEDDDHSGG
FT                   GGGSPQTPGGQPPASPAPGTHQSRFSVQDIASDTSLLSVDLDEDTLSQYDETFQTIRRA
FT                   LFENSFGDILQNSARWISTLEAMALADGNAPYTLLAQYLNGIEEAYTNFRNTGHISRAT
FT                   LSGFFVLEDSLRAAGIAFGGTTPTQTIQNQSADSPARRWKTRFEQIACELGDASIKSLA
FT                   DLADIIDTERERGDLTQFDVLAASSISSLCRAVRIISDTTDPNTQLALVENATAMQNNI
FT                   NAILGTNVSIPFLSATRRLLITRRIQEAGAESRSGATPDTIQQLADAELAEIVSEANMF
FT                   NEMAASQRDIANATREATIREHVLSPVNALANVGMAAAFFRSGGLRSRAFHPTMPTMPG
FT                   SPAAIGRPMFQAFRGRGHRLNRR"
FT   polyA_site      3524
XX
SQ   Sequence 3524 BP; 912 A; 990 C; 786 G; 836 T; 0 other;

X90904  Length: 3524  December 21, 2001 16:04  Type: N  Check: 3756  ..
       1  aaaaaataaa actacacaaa aacccaacga cttaaaacga tcacaatcaa
      51  acgagcaaac acacaacaag caaacacaac agattgcagc gcacagttct
     101  gaaacacgaa ctcatccact gcagtcttgg aatccgatcg cgatgatgat
     151  gaactctacg attcgccaag gatggcagca agtgctcagg cgcttttcca
     201  tcccagcatc cggagataga ctcatcgtct ccaattccac tgatcagccc
     251  ataggtcttt tcggagcatt tgatacatca ctccaaacac tctcacaagt
     301  caccaatgac cctgagattt tgaagcagaa gtccaacatc cccacgcatc
     351  tagacatagc atctgtgctc gaaaccagcc ctcgatcttt tccatgggtt
     401  ttcctcacaa actccttctg cactttcggt ggctccatac acgctcagaa
     451  ccttcaagcc tttgcaaccg ccgagttcaa gagtggattt tgttacatga
     501  acctgctgat accgcttagc ttcgacatca tcgatgcaca cgccgattcc
     551  ttccgcggtt ttgtcgaaca actccctgat acgctaggtg cctatccttc
     601  gctcagcatg gtactaaacg tcatgctgca cgcagctacg cgcttcccag
     651  agattgttgc ttcccccgtt ccaactatag cattcgatgc tgaatcactg
     701  caatttcatg taactgataa acggggcgtc cctggcatgt ggaacatact
     751  taaggcctgc cgcgtgtatg agctcctctc gcttgctgcg gatggcatag
     801  gctgcgagta catgctgtat cccgttggcg ctgcgcccca atactccttc
     851  tggaagaaat ccatggacca cttcatatct gaccggtttg tggaattctt
     901  agccatgcag ggtttgcttg ctagtgcact tgagcaggat tacaaaacac
     951  acgacgcacg cgatgcatta ctcacagctc tacagaacgc aggttacacg
    1001  aatgttgtcg caagagaacg gagatttcca aacggccatg acccaagcac
    1051  cgtctggttg aacctgaacg aggctcccat ttcagagaag ctaactgagc
    1101  tcaaacgata cctcctggtt ggtcacagaa gcgatgagat tgcggacatc
    1151  acacacaacg ttcaccagca cgtcttcgag gttcttaaaa ccatgtctgt
    1201  ccagtttagc aagacaacca acgcttacaa ccgcgcccgt tttgaggtta
    1251  accatgaggt gatatggaat gcagagtacg gacgcagttc tcaacaaaac
    1301  gctgagctcg aagcccttgt tctatttctc aatagacagt cgctagagat
    1351  cgaaaacatt ctgcgcagaa caactagtcc cgttgttgtg acgaactggc
    1401  agcctgatgt tcctcccgca gcacctgaaa tcagcgaagg ggagccaacg
    1451  catgcagtcg caacaccaat aactgaggca ccaacacatg caactcctgt
    1501  tgaagttgtg aatttgccac caacacgctc ttattgggcc gaaacactcg
    1551  ttggtgtgtt aaccgcaatt ttgggaacca tcttcgcctt gctcactcgg
    1601  gcgctcattc gcccaaagag gctgcggaga aaatccacct ttccctgggt
    1651  gtcactagac tctggagacg aagatgatga ccattctggt ggaggaggag
    1701  gtagcccaca aacacccggc gggcagcccc cagcctcgcc agcacccgga
    1751  actcaccagt cgcgcttttc cgtgcaagat atagcatcgg acacgagcct
    1801  actgagtgtg gaccttgatg aagacacact ctcccagtac gacgaaactt
    1851  tccagacaat tcgtcgtgcg ctcttcgaga acagttttgg agacatcctg
    1901  caaaactcag ctcgctggat ctccacactg gaggcgatgg ctcttgcaga
    1951  tggcaatgcc ccttacacgc tccttgcgca gtaccttaac ggaatcgagg
    2001  aggcatacac aaactttcgc aacacagggc atatctcccg tgcaacattg
    2051  tcaggcttct tcgttctgga ggatagtctg cgtgcggctg gcatagcttt
    2101  tgggggcaca acgcccacgc aaactataca aaaccagtct gctgactccc
    2151  cagcccgtcg atggaaaaca cgctttgagc agatcgcatg cgaactaggt
    2201  gatgctagca tcaagtcgct tgcagatctt gcagacatca tcgacactga
    2251  gcgtgagaga ggagacttaa ctcagtttga tgttctcgca gcttcctcca
    2301  taagcagtct ctgccgcgct gtccgtatta tcagtgacac aactgatcca
    2351  aacacacaac tagctcttgt cgagaacgca actgctatgc aaaacaacat
    2401  aaacgccatc ctaggcacga atgttagcat ccctttcctc agcgcaacgc
    2451  gtcgcctgct cataacacgt cgcattcaag aagctggagc ggagagccgc
    2501  tctggcgcaa cgccagacac catacagcag ctcgccgatg ctgagctagc
    2551  ggaaattgtc agcgaggcaa acatgttcaa tgagatggct gctagtcaga
    2601  gagatattgc caatgcaaca cgcgaagcta ccattcgtga gcatgtactt
    2651  agtcctgtta atgccttggc caatgttggc atggcggctg ctttcttccg
    2701  atctggtggt ttgcgttcga gggcttttca tcccacaatg ccaacaatgc
    2751  ctggtagtcc tgccgccata gggcggccaa tgtttcaagc ctttagagga
    2801  cgagggcacc gtctcaatag acgttaaaac cctgtgcttt ggcacagcac
    2851  tgaacaagcg acacgcgctt gttgtgataa ttgattccac gcttagcgtg
    2901  ccactgaaca aacgacacac gtttgttgtg ataattaatt aatttttgcg
    2951  cagactctgt ctgtgttttc tagagtgtgc tgctcggcag ctgcatcgga
    3001  gggttttacg ggaacgacat catcacaccc catccacaaa ccgccctgca
    3051  ttcacatctt tgtgccactt taaatactca tacgcatagg caagtgcctt
    3101  tccggcagag catcccctgg catcgacact cacgcgatcg caatcaactg
    3151  acttaatcct cggttttgca atcatatagt gagttctacc cctggacgtg
    3201  ttcccccgga actgcaatcc tcgttatgtt gtcgctgatt actatcagct
    3251  cgtaaaccat gatatccacc cacaattagc tattcgtgta ctagcatcat
    3301  cggatacgcc tatcctgcac ttaagcctgc aggacgctat caggtccgct
    3351  gactgttacc atttgtgtag ctcgttgtgg ttccgcctca tatctaaatt
    3401  cagtacctgc atacaaaacg tcatgcatcc ctgttcaaca tgagcacggg
    3451  tttgggaaga agcaagtcat catagactgc tggcattgtt aggttgacaa
    3501  tgcttatgta cacaggaacg tgac