!!NA_SEQUENCE 1.0
ID   ACLSVCOMP  standard; genomic RNA; VRL; 7549 BP.
XX
AC   X99752;
XX
SV   X99752.1
XX
DT   16-MAY-1997 (Rel. 51, Created)
DT   09-SEP-2004 (Rel. 81, Last updated, Version 4)
XX
DE   Apple spot chlorotic leaf spot trichovirus complete genomic RNA
XX
KW   coat protein; complete genome.
XX
OS   Apple chlorotic leaf spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Flexiviridae;
OC   Trichovirus.
XX
RN   [1]
RX   MEDLINE; 97314166.
RX   PUBMED; 9170508.
RA   German S., Bergey B., Delbos R.P., Candresse T., Dunez J.;
RT   "Complete nucleotide sequence of the genome of a severe cherry isolate of
RT   apple chlorotic leaf spot trichovirus (ACLSV)";
RL   Arch. Virol. 142(4):833-841(1997).
XX
RN   [2]
RP   1-7549
RA   Candresse T.;
RT   ;
RL   Submitted (01-AUG-1996) to the EMBL/GenBank/DDBJ databases.
RL   T. Candresse, INRA, Pathologie Vegetale, BP81, 33883 Villenave d'Ornon
RL   Cedex, FRANCE
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .7549
FT                   /db_xref="taxon:12175"
FT                   /mol_type="genomic RNA"
FT                   /organism="Apple chlorotic leaf spot virus"
FT                   /strain="Balaton1"
FT   CDS             149. .5812
FT                   /db_xref="GOA:O12658"
FT                   /db_xref="UniProt/TrEMBL:O12658"
FT                   /gene="ORF1"
FT                   /product="216K protein"
FT                   /protein_id="CAA68080.1"
FT                   /translation="MAFSYRTPQEELLSRLPQAQQEVISGFQFERIQKEEEKKVENFSF
FT                   YLPEKTREWFTKSGVYLSPFAYVNHSHPGCKTLENHLLFNVVASYISKYSYVACLSIKA
FT                   NKMSKMERLGPNSVKTYDVLNRLVTAKDKARYGPLAKPERAPCPKKTNIFIHDEIHYWS
FT                   RDQLESFLQVYKPKNLWATLVFPPEILAGYRSSVLPFLYQFEIHGKDLIYMPDGVRSES
FT                   YTQPLENGFLLSSSSIIIKNKNDGSELRYQVSLIYSLGSHHLFHMYPTENLLKEEVRRF
FT                   GPYDLFDVGSLFVKPVRVPIQDFPLSVFKKIFIYLSSLKKPDVQSAVAKLRQLSDADIS
FT                   IESVFMVQEFASRIEKEGIEGWSCSFWGCMKDWFFDKLPYREVLEKIGLADDFTRRLMK
FT                   IKPLAFDIHTSDRPLTVRMVIDQIWEERCSVNDDISNIIFYGRNEWMEHGIVPRIKKGM
FT                   AKLINRKEALPSRYPVEIYSDLLSSTSVWKSHDEDLGRRKASKFVILRSNKSYSSAKMP
FT                   HTNCLSICAVPSEEKIPKTSYELRKADHKKDISIKCLDFHMKKAKVKTLSELEIKFKNS
FT                   VYEKERIKRRAGKKARARMIPIHLLPNGCPNEDGKKIGERIDGRTMTNELFSETKEDKK
FT                   VEIVSESDALKKKVEISASESAHSVNSPSTSLSHLIGKMEICSAGLVKTVGNDHSALAK
FT                   QIEDLPLAQLKNKKAAYFCIDYPMVYFHDKVSYPTFEAIGEIKQTILKARERWGVNFNS
FT                   ALIQVYKDGCRLPLHSDNEECYDDDGILTINVIGDAKFHTTCHDEIIELKQGNELLMPA
FT                   NFQKRNRHAVEVTSEGRASVTLRVHKRDFSFESKLRFIKGKYDCLFASVAEIIHKKPEE
FT                   VMMFLPHIMDRCISNKGCSIDDAKAICEKYEIKIECEGDCGLIECGCIGLPVGRMLLRG
FT                   NHFSVASVRRSSIDSLANSAKEIKSNGVLDHVMFNFHKRLKMVEPDLTNDEIKVDIERA
FT                   GKLLKSLMDGMTGIVSHNSTHEGWRMIKGINSTSEMRNFMSMIKGKGDEQKGDFYDKVQ
FT                   ELNFTKVKIYGIFGFAGSGKSYAIQNLIHTEFKNSQGIMVICPRRFLAKDWSEKGVDEK
FT                   DIKTFESALKSDIKGKRLFILDEVSLLPKGFTDLLMLKMHMEGVLKKSTIVCVGDPLQA
FT                   SYFCPKDDNYLSREGEIKRLFKNGVLYKWYSHRINKFVAKKLAISTTNEFIGIDEQSSV
FT                   YKDMPSAHHFMEKKGNHVEVILVASMVEKELYSNYGNTMTFGESQGLTFNCGVIVLSEE
FT                   AKLCSDAHIMVAVTRFRKGFCFALGSKGSKEDYMRSMKSGLLQRMCSGIGASKEFILGS
FT                   SSVKLILSEKDLAKGAGIDEMDREARLEGDVWLKSMIYLGKRYHMVEPLGQVIKLTDNA
FT                   IKCHIPVCSFQTLGPELDFIQAREFREFKSRSGWSNQFREEAGPNWKAPYKVNQAMSYE
FT                   AIYPRHKMDDDLTFLAAIKKRLRFDNVANNYSKFKAAESRGKYLAKIFLKHVPIKCGRD
FT                   QRLLDQCRQEFEETKLSKSAATIGAHSQRSDSDWPLDKIFLFMKSQLCTKFEKRFTEAK
FT                   AGQTLACFPHKILVEFSPWCRYTEKVLTANLPDNYYIHQRKNFSELEDFARRFSNGSMC
FT                   VESDYTAFDVSQDHTILAFEVELLRHFGWDEKILQSYIRMKCTLGCRLGGFAIMRFTGE
FT                   FSTFLFNTLANMVFTFCRYEVPDGQPICFAGDDMCALRNLREIDTHEFILNKLSLKAKV
FT                   NRTRVPMFCGWRLCCDGLIKEPCLIYERLQVAIENGRLMDVIDSYFLEFSFAYKLGERL
FT                   FSHLEIEQLNYHQVLTRFFIRNKHLLRGDSRHNISELEWLSDEDGIDDKGSQVEDRRRG
FT                   YSNCWGEKLQNLF"
FT   CDS             5724. .7106
FT                   /db_xref="GOA:O12659"
FT                   /db_xref="UniProt/TrEMBL:O12659"
FT                   /gene="ORF2"
FT                   /product="50K protein"
FT                   /protein_id="CAA68081.1"
FT                   /translation="MALMIRGHKLKIAEGDIPIAGVKSSRIYSDISPFKRASDLMIHWN
FT                   EFVFKVMPEDIAGDGFRLASIPVIPSTEVQAVLRKRESTNYVHWGALSISIDALFRKNA
FT                   GVSGWCYVYDNRWETFEQAMLQKFHFNLDSGSATMVTSPNFPVSLDDPGLSNSISVAVM
FT                   FENLNFKLESYPISVRVGNMCRFFDSFLSSVKNRVDSNFLLETSNADPLGAGAFGFEND
FT                   DQVSELFDYIQTVPTQAIKSRELEIPKGFFGMLGKKKVKSFEFASESRNKNKTKPLRGR
FT                   PATRSASQRELPGFKSQADEVEHQRLFTDEDFEEFIKSRGRRRAGSRSITSEGSSLDNI
FT                   STREFQSAREDQKKEDGCGFKSTAKGGRRSESVPCKRKQTPSWKDRGNPGTDTGVHLRE
FT                   HSSARDVGAHRILGPDSGGQVDGGSEHLGVVQFEGGGEPDQSLQNYIFGPEYQRNDFPP
FT                   SL"
FT   CDS             6622. .7371
FT                   /db_xref="GOA:O12660"
FT                   /db_xref="UniProt/TrEMBL:O12660"
FT                   /gene="ORF3"
FT                   /product="28K protein"
FT                   /protein_id="CAA68082.1"
FT                   /translation="MRLNIKGYSLTRILRNSSKAEGEEGLDRDQSRQRVHLSITSLLEN
FT                   FSLLEKIRRRRMAAVLNLQLKVDADLKAFLAKENRPLHGKTGATLEQILESIFANIAVQ
FT                   GTSEHTEFLDLTVEVKSMEDQSTLGSYNLREVVNLIKAFKTTSSDPNISGMTFRQVCEA
FT                   FAPEARNGLVKLKYKGVFTNLFTTMPEVGGKYPELMFDFNKGLNMFIMNKAQQKVITNM
FT                   NRRLLQTEFAKNESEAKISSVSTDLCI"
FT   CDS             6790. .7371
FT                   /db_xref="GOA:O36197"
FT                   /db_xref="UniProt/TrEMBL:O36197"
FT                   /gene="coat protein"
FT                   /protein_id="CAA68083.1"
FT                   /translation="MAAVLNLQLKVDADLKAFLAKENRPLHGKTGATLEQILESIFANI
FT                   AVQGTSEHTEFLDLTVEVKSMEDQSTLGSYNLREVVNLIKAFKTTSSDPNISGMTFRQV
FT                   CEAFAPEARNGLVKLKYKGVFTNLFTTMPEVGGKYPELMFDFNKGLNMFIMNKAQQKVI
FT                   TNMNRRLLQTEFAKNESEAKISSVSTDLCI"
XX
SQ   Sequence 7549 BP; 2412 A; 1347 C; 1764 G; 2026 T; 0 other;

X99752  Length: 7549  September 14, 2004 08:36  Type: N  Check: 5506  ..
       1  ggatactgat gctatgtgct ctcacgacgt gagtaaacag attgacgtaa
      51  cgcctcaatc gtgatcaagg atcagcattc aatgctacca aattaaatac
     101  aatctctttg tatctcataa cccttcgttt cggacgtcgg agtaaagaat
     151  ggctttctca tacagaacgc cacaagaaga actcttgagc aggcttccac
     201  aagctcaaca agaggtgata agcggatttc aatttgaacg tattcaaaaa
     251  gaggaagaga agaaggtgga aaacttttct ttctacttac cagagaaaac
     301  tagggaatgg ttcaccaaat cgggtgtcta cttgtcccct tttgcttacg
     351  ttaaccactc tcaccctggt tgcaaaactc tggagaacca ccttttattt
     401  aatgtcgtag ctagttatat tagtaaatat tcttatgtag cttgccttag
     451  tatcaaggcc aataagatga gcaaaatgga gcgtctgggc ccaaattctg
     501  tcaagaccta tgatgtgctt aatagactag tcacggccaa agacaaagct
     551  cgctatggcc ctttagctaa accggagaga gcaccatgcc cgaagaaaac
     601  aaatatcttc attcatgatg agattcacta ttggtcaaga gatcaattgg
     651  agtcctttct tcaagtttac aaaccaaaga acctctgggc taccttggtt
     701  tttcctcctg aaatcttggc cggctataga tcttcagtgt taccttttct
     751  ttatcaattt gagatacatg gtaaagatct catatacatg cctgatgggg
     801  taagatcaga aagctacacc caacctttgg agaatggttt tctactgagt
     851  tcaagcagta taataatcaa aaataaaaat gatgggtccg aactcaggta
     901  ccaagttagc ttgatctact ccttaggttc ccatcacttg tttcacatgt
     951  atccaacaga gaatctttta aaagaggagg tgaggagatt tgggccatat
    1001  gatttatttg atgtgggttc tctctttgtt aagccagttc gtgtacctat
    1051  tcaagacttt cctttaagcg ttttcaaaaa aatatttatt tacttgagct
    1101  cattaaagaa gcctgatgtt caatcagctg ttgccaaact tagacagctc
    1151  tccgatgcag atatttccat tgaaagcgtc ttcatggtgc aagaattcgc
    1201  aagcaggata gaaaaggaag gtattgaggg atggtcttgc tccttctggg
    1251  gttgtatgaa agattggttt tttgacaaat tgccttacag ggaagttctt
    1301  gaaaaaattg ggctggcaga tgactttaca agaagattaa tgaaaatcaa
    1351  gcctcttgct tttgacatac acacatcaga cagacctttg acagtcagga
    1401  tggtgattga ccaaatatgg gaagagaggt gcagtgtgaa tgatgatatc
    1451  tcaaatatca tcttttacgg gaggaacgaa tggatggaac atggtattgt
    1501  gccaagaata aagaaaggaa tggccaaact tattaacaga aaggaagccc
    1551  taccgagtag gtacccagtg gaaatttact ctgatttgct ttcctccacc
    1601  tctgtatgga agtctcatga tgaggatctg ggcagaagaa aggccagcaa
    1651  gtttgttatc ttaaggtcca acaagagtta ctccagcgca aaaatgccac
    1701  atacaaactg tctcagtata tgtgcggtcc cttctgagga gaagattcca
    1751  aaaacctcat atgagctgag gaaagcggat cacaaaaagg acatctcgat
    1801  taaatgcctc gactttcaca tgaaaaaagc aaaagtcaag actctctctg
    1851  aacttgaaat taaattcaaa aactctgtgt atgaaaaaga gaggattaaa
    1901  aggagagcag gcaaaaaggc aagagccaga atgattccaa ttcatttgct
    1951  cccaaatggt tgtccaaatg aagatggaaa gaagattggt gaaaggattg
    2001  atggcagaac tatgacaaat gaactctttt ctgagacaaa agaagacaag
    2051  aaagtagaga ttgtgagtga atcagatgca ctcaagaaga aagtggaaat
    2101  ctctgcttct gaaagcgctc attcagttaa ttctccctca acttctctgt
    2151  cacatctcat tggcaaaatg gaaatctgct cagcaggtct tgtcaaaact
    2201  gttggaaatg atcattcagc tctggcaaaa caaattgaag atctaccgct
    2251  tgcccagctg aaaaacaaaa aagcagcata cttctgcatt gattacccaa
    2301  tggtttattt tcatgacaag gtttcatacc caacttttga agcaatcggg
    2351  gagatcaagc aaacaatact gaaagcaaga gagaggtggg gggtgaactt
    2401  caatagtgcc cttattcaag tgtacaagga tggttgcagg ttacctctgc
    2451  atagtgacaa tgaggaatgt tatgatgatg atggtatctt gacaatcaat
    2501  gtcattggtg atgcaaaatt tcacacaaca tgtcatgatg aaatcattga
    2551  attgaagcaa gggaatgaat tgttgatgcc tgccaatttt caaaagagaa
    2601  acagacatgc tgttgaggtt acatcagagg gcagagcaag tgtgacattg
    2651  agagttcaca aaagggactt cagttttgaa tcaaaactaa ggttcatcaa
    2701  aggaaagtat gactgtctct tcgcaagtgt tgctgaaata atccacaaaa
    2751  aacctgagga ggttatgatg tttttacctc acataatgga cagatgtata
    2801  agcaataaag gttgctccat tgatgatgca aaggcaatat gtgagaagta
    2851  tgagatcaaa atagagtgcg aaggtgattg tgggctcata gagtgcgggt
    2901  gcattggttt accagtaggc aggatgctcc ttagaggaaa ccatttctca
    2951  gttgcgtcag taaggagatc atctattgat tcacttgcca actcagccaa
    3001  agagatcaaa tcgaacggtg tgcttgatca tgtgatgttc aatttccaca
    3051  aaaggctaaa aatggtggaa cccgacttga ccaatgatga gatcaaagtt
    3101  gacatagagc gggctggcaa acttcttaaa agtttgatgg atggcatgac
    3151  cggaatagtc tcacacaact caactcatga gggttggaga atgatcaaag
    3201  gcatcaacag cacttcagag atgagaaatt tcatgagtat gatcaaaggt
    3251  aaaggggatg aacagaaagg tgatttttat gacaaagtcc aggagctcaa
    3301  tttcacaaaa gtgaagattt atgggatttt tggcttcgca ggctcaggaa
    3351  agagctatgc aattcaaaac ctcattcaca cagaatttaa aaattcccaa
    3401  ggaatcatgg tcatatgccc aaggagattt ctggccaagg attggtcaga
    3451  gaaaggggtg gatgagaagg acatcaaaac ctttgaaagt gcactcaaat
    3501  ctgacattaa aggaaaaaga cttttcatcc ttgatgaggt cagtctctta
    3551  cccaagggtt ttacagatct gcttatgctc aagatgcata tggaaggtgt
    3601  tctcaaaaaa tcaactatag tttgtgttgg cgacccactt caggctagtt
    3651  atttctgccc caaagatgat aattatctat caagagaagg ggaaatcaag
    3701  aggctcttca agaatggtgt cctttacaag tggtatagtc acaggataaa
    3751  taaatttgtg gcgaagaagt tggcaattag tacaacaaat gagttcattg
    3801  gcatagatga acagagttca gtttacaagg acatgccatc tgctcaccat
    3851  ttcatggaga agaaaggaaa tcatgttgaa gttattcttg tggccagtat
    3901  ggttgagaag gaactgtatt caaattacgg caacaccatg acttttgggg
    3951  aatcccaagg tctcacattt aactgtggtg tgattgtact gtcggaggag
    4001  gctaagttgt gctcagatgc ccacatcatg gttgcagtca caagatttag
    4051  gaaaggtttt tgctttgcat tgggaagcaa aggttcaaaa gaggactaca
    4101  tgagatccat gaagagtgga cttcttcaga gaatgtgctc gggaataggg
    4151  gcttcaaagg aattcatact tgggtcatca tcagttaagc tgatcttgag
    4201  tgaaaaagat ttggccaaag gggctgggat tgatgaaatg gacagagagg
    4251  ccaggctaga aggcgacgtt tggctcaaaa gtatgatata ccttggaaag
    4301  aggtaccata tggtggaacc gcttggtcaa gttatcaaac taactgacaa
    4351  tgcgataaag tgtcacatac ctgtatgttc atttcagact cttggacctg
    4401  agttggattt cattcaagca agggaattca gagagtttaa gagcaggagt
    4451  ggctggtcta atcaattcag ggaagaggct gggcccaact ggaaagctcc
    4501  ttataaagtg aatcaggcca tgagttatga agccatatac ccaagacaca
    4551  agatggatga tgatttaact tttctggctg ctataaagaa gagattgcgg
    4601  tttgataatg tggccaacaa ttattcaaaa ttcaaggcag cagagagcag
    4651  gggaaaatat cttgcgaaaa tatttcttaa gcatgtgcca atcaaatgtg
    4701  gaagggatca gaggcttctg gaccaatgca ggcaggaatt tgaggaaacg
    4751  aaactttcca aaagcgcagc tactataggg gctcattcgc agagatctga
    4801  ttcagactgg ccccttgata agatattcct cttcatgaaa tcacaactct
    4851  gtacaaaatt tgagaagagg tttaccgagg ccaaagcagg tcagacattg
    4901  gcgtgtttcc cacataaaat tcttgttgaa ttcagccctt ggtgcaggta
    4951  cacggaaaaa gttctcactg caaatctccc ggataattac tacatccatc
    5001  aaagaaaaaa tttcagtgaa ttggaggact ttgccagacg attttcaaat
    5051  ggatcaatgt gcgttgaatc ggattacaca gcttttgacg tctcgcaaga
    5101  tcatacgata cttgcttttg aggttgaact tcttagacat tttggctggg
    5151  atgagaagat attgcaaagt tacataagaa tgaaatgcac attggggtgc
    5201  agactcgggg gctttgcgat aatgagattc actggagagt tctccacttt
    5251  cttgttcaat accttagcca acatggtttt caccttctgc agatatgaag
    5301  tgccagatgg ccaaccaatt tgctttgctg gggatgatat gtgtgcactg
    5351  aggaatctca gggagatcga tactcatgaa ttcatattga acaaattgag
    5401  ccttaaagca aaagttaata gaacgagagt cccgatgttt tgcggatggc
    5451  gattatgctg tgatgggttg atcaaagagc cctgcctgat atatgagagg
    5501  ttgcaagttg caatagagaa tggcagattg atggatgtaa tagattctta
    5551  cttcctggaa ttttcatttg cctacaagtt aggtgagagg ctcttttcac
    5601  atcttgaaat tgaacagttg aattatcatc aggtgttaac cagatttttc
    5651  ataaggaata agcatttgtt gaggggtgac tcacgacaca atatttctga
    5701  acttgagtgg ctgtcggacg aagatggcat tgatgataag gggtcacaag
    5751  ttgaagatcg cagaagggga tattccaatt gctggggtga aaagctccag
    5801  aatctattct gacataagtc ccttcaaaag agcctctgac ctcatgatac
    5851  attggaatga attcgtgttt aaggtcatgc cagaagatat agcaggagat
    5901  ggattcagat tggcttcaat accggtgatt ccttcgaccg aggtacaagc
    5951  tgttttaaga aagagggaaa gtacaaatta cgtgcattgg ggcgcactct
    6001  ctatatcaat agatgccctc ttcaggaaaa atgccggagt atctgggtgg
    6051  tgttatgttt acgacaatag gtgggaaaca tttgaacaag caatgttgca
    6101  gaagtttcat ttcaatctgg atagtggatc tgcaacaatg gtgacctcac
    6151  cgaattttcc agtgtctttg gatgacccag gtctttcaaa ttcaataagt
    6201  gttgccgtca tgtttgagaa cctcaatttc aaattagaaa gttatccaat
    6251  aagcgttaga gtcggcaaca tgtgtaggtt ctttgacagt ttcttgagca
    6301  gtgtaaagaa cagggtggat tcaaatttcc tactggagac ttcaaatgct
    6351  gacccacttg gtgcgggagc attcggattt gagaatgacg atcaagtgag
    6401  tgaactcttt gattacatac aaactgttcc aactcaagca atcaaatcaa
    6451  gggagctcga gatcccaaaa ggtttcttcg ggatgctagg caagaaaaag
    6501  gttaaatctt ttgagtttgc atcagaatct agaaacaaaa acaaaacaaa
    6551  gcctttaaga ggcagaccag cgacgaggtc agctagccaa agagaattgc
    6601  ctggatttaa gtcccaggct gatgaggttg aacatcaaag gttattcact
    6651  gacgaggatt ttgaggaatt catcaaaagc agagggagaa gaagggctgg
    6701  atcgagatca atcacgtcag agggttcatc tctcgataac atctctacta
    6751  gagaatttca gtctgctcga gaagatcaga agaaggagga tggctgcggt
    6801  tttaaatcta cagctaaagg tggacgcaga tctgaaagcg ttccttgcaa
    6851  aagaaaacag accccttcat ggaaagacag gggcaaccct ggaacagata
    6901  ctggagtcca tcttcgcgaa catagcagtg caagggacgt cggagcacac
    6951  agaattcttg gacctgacag tggaggtcaa gtcgatggag gatcagagca
    7001  ccttggggtc gtacaatttg agggaggtgg tgaacctgat caaagccttc
    7051  aaaactacat cttcggaccc gaatatcagc ggaatgactt tccgccaagt
    7101  ttgtgaagca tttgctccgg aggcaaggaa tgggttggtg aaactgaagt
    7151  acaaaggggt gtttacaaat ctgttcacta ccatgccaga agtaggtggt
    7201  aagtacccag aattaatgtt tgatttcaac aaagggctca acatgttcat
    7251  catgaacaag gcccaacaga aagttataac taatatgaat cggcgccttt
    7301  tacaaactga atttgcaaag aatgaaagtg aggcgaagat ttcatctgtt
    7351  tcgactgacc tttgcattta atgcattgag aagagtcagt ttaatgaata
    7401  attgagtggg tagatgttgt gtttgtgcat gtcaattctg tcatttgatt
    7451  aactctagaa cccgtgaaag agtataaaga gtcacggtga atgaatggag
    7501  tgtttagact tataataaat agcctgtaga cttttaaata ttttactac