!!NA_SEQUENCE 1.0
ID   BMMVRNA1F  standard; genomic RNA; VRL; 7262 BP.
XX
AC   Y10973;
XX
SV   Y10973.1
XX
DT   02-DEC-1997 (Rel. 53, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Barley mild mosaic virus RNA1, isolate UK-F
XX
KW   RNA1 gene; RNA1 polyprotein.
XX
OS   Barley mild mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Bymovirus.
XX
RN   [1]
RA   Peerenboom E., Cartwright E.J., Foulds I., Adams M.J., Stratford R.,
RA   Rosner A., Steinbiss H.H., Antoniw J.F.;
RT   "Complete RNA1 sequences of two UK isolates of barley mild mosaic virus: a
RT   wild type fugally transmissible isolate and a non-fungally transmissible
RT   derivative";
RL   Unpublished.
XX
RN   [2]
RP   1-7262
RA   Antoniw J.F.;
RT   ;
RL   Submitted (03-FEB-1997) to the EMBL/GenBank/DDBJ databases.
RL   J.F. Antoniw, IACR-ROTHAMPSTED, Crop and Disease Management Department,
RL   Harpenden, Herts, AL5 2JQ, UK
XX
CC   Related sequence X90904
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .7262
FT                   /db_xref="taxon:12466"
FT                   /mol_type="genomic RNA"
FT                   /organism="Barley mild mosaic virus"
FT                   /strain="common"
FT                   /isolate="UK-F"
FT                   /lab_host="barley"
FT                   /specific_host="barley"
FT   5'UTR           <1. .148
FT   CDS             149. .6925
FT                   /db_xref="GOA:O55459"
FT                   /db_xref="HSSP:1HEI"
FT                   /db_xref="InterPro:IPR001205"
FT                   /db_xref="InterPro:IPR001410"
FT                   /db_xref="InterPro:IPR001592"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001730"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="UniProt/TrEMBL:O55459"
FT                   /gene="RNA1"
FT                   /product="RNA1 polyprotein"
FT                   /protein_id="CAA71869.1"
FT                   /translation="MEEFIPEVFYQNQVQSLKKILKSWKRDTSIYAYLAREQEVLAFLV
FT                   LSPAHIAKLNKLLTEESARCALLAQNCETIEALAVVRQALQGVTLHFGDNGMEKGWLHM
FT                   MKALDACLDESFSENAAALKKSIQAVGHKLIAAKNRIEGCERSVNHLTTFQFAREYGLS
FT                   TTYFEKLSNFGGHIRSFVWSSDSGEIFPKLKRSSRTRRISTFTSYYWGEFWCNCIWFLC
FT                   CCWSPARWCFNSAVFIWSLCGVLNLSMIVLQFALKRHFGRYYFRYIMSGVLAICAVCCV
FT                   HLKNRKGPILQASQKDKRLIGILAFCITVIYMFDVDLADSLSNNLHKISRLVNLFLDDN
FT                   RGFATPALDNLTDFTTILQSGTSSDDLKIVQDTLAVVLQVDEEDATQDDAIYDSDGLQT
FT                   FKQWVSHNQLAGMHLARPLQYPCSNTYGLTADNVAELATSMAQEAKQWSQVVGHTGSGK
FT                   STRLPTAYANCLKGLAGRKKNVLVCEPTRAATVNVTSGISQNFGRLVYGRHEGWSNLGD
FT                   KTIQVMTYGSALAAWKVDNKFLSQFDAVFLDESHLITTHALVFESICQEVTNVRKFYVS
FT                   ATPRDGKKCPEAVRRYEIKTVKTECSSVDTFVRSQEKENTLYVLNHDTVLVFLAGKAEC
FT                   DRAASNWNKLYSTNMYAYSLTGDNFTIAYEKIVTRMLTERTIVFCTNILETGVTLNVDC
FT                   VVDFGFTMRPELDLVDKSLTLMRRRVTENERAQRIGRAGRLRTGYAICIGNPETRHDLV
FT                   PPETLYEAALLSFVHGVQFYINEHFENAWIEGVTKSQASVMTQFKLSPFLMRDIVRDDG
FT                   AIPLSLHKILKDYTHRNTDLIGTKLSVMSHIYNSWPLYRTVHQSIFRGDSNVPQTLRYA
FT                   RVPFNVSTAHDFPWEDFAQACLEFQPRVLQVFSDNSSTSRIINLQIGKMHIVNSMEEVK
FT                   INIHSYQRSAENLRSVKDSFESSIFRTKLLRGNPTGKITKRIETLLDNVRVLQQVHAKL
FT                   EMIAYSGGEKVNMDKKSVDELNEIVELQSKNSLTAEELARILHLTKPTSTFFNLFAERG
FT                   RQMLVTLLVMVAASLMYLVFWVSPRKQDDITIEGKGRAYNRDKRMGYDSYEEDEVRNKI
FT                   NKKFKERSTRFSNDSKPETNSKYRNLKQEFVNFYDLKTDANVLQAVFTAMDGAVLLQTE
FT                   SPMADIGRVNRLLQDHFGDSESRAVHEGLNTMVKCHLTMKDGRQFELDMEQHDPEYVAK
FT                   LGGEVGFRMNRDDLRQVGATRYINPRAQTSAATLEGMTMKPMSSFTIDSAKMVGFIKTA
FT                   KDTLNCILYGDWIIAPAHIQQGEGDITFIFQHIQFTTTTERLASYGIRQFKGLDLVVIR
FT                   RPQQIRAVKKDMRASILDTPTEIQMLYLSVKGGKYQVSTSAVCFPHYNNRWGHVISTAE
FT                   GMCGCIVFDPTTNHIVGIHVSYNDTRRRNEFQAFTSDVLTTINAPGHEIPFSPWVFDWK
FT                   FCGYTTKPRNMQSAPSTLERLNINATGFGFKLNAQEIKPAMLRSTESFSREFPNTQFKL
FT                   IGEVKKGLIDKHTITGENPYFLEFLDTFKPYQWVQAFMDEYAPSILAYDAYFKDLKKYD
FT                   RPPHANAFCQNTLTKAKNKMINILEEAGMGRTLVRTTEQVLLDMAWTTSGGPLYHGKKI
FT                   DIVQHLSDDELVQFSEACQQALITGTLDGVWNGSLKAELRSSQKILERKTRVFTAAPIT
FT                   SLIAMKYYVDDFNKQFYKTHLKAPHTVGINKFNRGWQNLYEKLNKPGWTHGSGDGSRFD
FT                   SSIDGFLFDVIKDIRKHFMDAEHHKELDTIYEEIVNTKICLANGLIIQKNCGNNSGQPS
FT                   TVVDNTLALMTAFLYAYVRLTGDHAFELMDENFVFVCNGDDNKFAMSPSFMTKFGCDFS
FT                   PFLSELGLTYEFDEATEDICENPYMSLTMVRTSFGIGFSLSIERIVAILQWSRAGGVLH
FT                   AYLSGIAALFESFNTPKLFNLVHTYLLWLITEHEEELFSMMELRDMFMPLPTKEQIALL
FT                   HYVGTEPIVEETFLQAGHEEPDPIVPPASDTDLTNMAAAPPDNRRSRAVIPRGTSDWSM
FT                   PEPTMRTLGFKSKIKIETLADVPEGYMNTFASVATESQRRKWEEATRGDFGITDDEKWE
FT                   KLLIAACIYFADNGTSPNFDEELTMEVNGGLNSIKEYPVRPFVVRAKKISTLRRIFRCY
FT                   SIETKLMFVKLRRVPHWAIKHGCLDEIVFDFMIPDQFTSRTALETLKQTKLAAIGVGTS
FT                   NSLLTSEQTNMRTTETRRRNDYDGHEALLR"
FT   mat_peptide     149. .1024
FT                   /gene="p3"
FT   mat_peptide     1025. .1225
FT                   /gene="6k1"
FT   mat_peptide     1226. .3199
FT                   /gene="CI"
FT                   /product="helicase"
FT   mat_peptide     3200. .3391
FT                   /gene="6k2"
FT   mat_peptide     3392. .3928
FT                   /gene="NIa-VPg"
FT   mat_peptide     3929. .4567
FT                   /gene="NIa"
FT                   /product="protease"
FT   mat_peptide     4568. .6169
FT                   /gene="NIb"
FT                   /product="replicase"
FT   mat_peptide     6170. .6922
FT                   /gene="CP"
FT                   /product="coat protein"
FT   3'UTR           6926. .>7262
FT   polyA_site      7262
XX
SQ   Sequence 7262 BP; 2052 A; 1898 C; 1609 G; 1702 T; 1 other;

   Y10973  Length: 7262  May 10, 2005 10:10  Type: N  Check: 2689  ..
       1  aaaaataaaa ctccactcca acccaataca aacaacgaac aacaaacaac
      51  gaatttgcaa cttaccacag caatatcgac cgctagtaac agtttaacca
     101  aactcagcaa caaatcatcc ttcgaccaaa cgaactctca ccatcgagat
     151  ggaggagttc attcctgaag tgttctacca gaaccaggtt cagagtctta
     201  agaaaattct taaatcctgg aaacgcgaca cttctattta cgcgtatctt
     251  gctcgcgagc aagaggtcct agccttcctt gtactgagtc ccgcacacat
     301  tgccaaattg aacaaactac tcactgagga gtctgcacga tgtgccctgc
     351  ttgcccagaa ctgtgaaacc atcgaagctc tggccgttgt tcggcaagcc
     401  ctgcagggtg tcacgctaca ctttggtgat aatggcatgg agaaaggctg
     451  gttgcatatg atgaaagcac ttgatgcatg tcttgacgaa agcttcagcg
     501  agaacgccgc cgcactcaag aaaagcattc aggcggttgg tcacaagctc
     551  atcgcagcaa aaaaccgcat cgaaggctgc gagcgatctg taaatcacct
     601  tacaacgttt caatttgctc gcgaatatgg cttaagtact acatacttcg
     651  aaaaattatc caatttcggt gggcatattc gaagttttgt gtggtccagc
     701  gactcaggag aaattttccc aaaactaaaa agatcatcac gtacgaggcg
     751  catctcgaca ttcacgagct actactgggg tgagttctgg tgcaactgca
     801  tctggttcct ctgctgctgt tggtctcccg cgcgctggtg ttttaattct
     851  gcagttttca tatggagtct atgtggcgtt ttaaacttat ctatgattgt
     901  tctacagttt gctcttaagc gtcattttgg tagatactat tttcgataca
     951  taatgtctgg tgtcctagct atttgcgccg tgtgttgtgt tcatcttaaa
    1001  aacagaaaag ggcctatatt gcaagcctcc caaaaagaca agcgtctcat
    1051  cggaatttta gctttctgca ttactgttat atacatgttt gatgttgatc
    1101  tagccgactc acttagcaat aatcttcaca agatctctcg ccttgtgaat
    1151  cttttccttg acgataaccg cggattcgca acacccgctc tcgacaatct
    1201  aacggacttc acaacaattc ttcaaagtgg aacatcaagt gacgacctaa
    1251  agattgtcca ggatacgttg gctgtggttt tacaagtcga cgaagaggac
    1301  gcaactcagg atgacgcaat atatgattcc gatggacttc aaactttcaa
    1351  gcaatgggtc tctcataacc aactagccgg aatgcatctt gcacgcccgt
    1401  tacaataccc gtgctcgaac acctatggcc tgaccgcaga taacgtcgca
    1451  gaactagcaa ctagcatggc acaggaggca aagcagtggt cacaagttgt
    1501  tggacacact ggttccggga agtccacacg actaccaact gcatacgcca
    1551  actgtttgaa aggcttagcc gggcgaaaga aaaacgttct cgtttgcgaa
    1601  cccactagag ctgcaaccgt caatgtaacc agcggcattt cacagaattt
    1651  tggtaggctt gtttacggac ggcatgaagg ctggagtaac cttggcgaca
    1701  aaacaataca agtcatgaca tatggttctg cactcgcagc gtggaaagtc
    1751  gacaacaaat tcctaagcca gtttgacgca gtgtttctcg acgaatctca
    1801  cctcatcacc acgcacgccc ttgtctttga gagcatctgc caggaggtta
    1851  caaacgtccg caagttctat gtgtcagcca caccccgcga tggcaagaag
    1901  tgtccagaag ccgtgcgtag gtatgaaatc aagactgtga aaaccgagtg
    1951  cagcagcgtc gacactttcg ttcgaagcca ggagaaggaa aacacgcttt
    2001  acgttctcaa tcacgacacc gtgctcgttt ttctcgctgg gaaggctgag
    2051  tgtgatagag cagcaagcaa ctggaacaag ctgtactcaa ccaacatgta
    2101  cgcgtactcc ctaacaggtg acaatttcac aatcgcatat gagaaaattg
    2151  tcacacgcat gctaactgag cgcaccatcg tattctgcac aaatatcctg
    2201  gaaaccggtg tcaccctcaa cgtggactgc gttgttgact ttggattcac
    2251  catgcgtcct gaacttgatc ttgttgacaa atcgctaacc ttgatgcgac
    2301  gccgagttac cgagaacgag cgtgcacaac gcatcgggcg tgcaggaagg
    2351  cttagaacag ggtacgcaat ctgcatcggc aatcccgaaa cgcgccacga
    2401  tctggtgcca ccagaaaccc tctacgaggc agcccttctt agcttcgttc
    2451  acggcgtgca attctacatc aatgagcact tcgagaacgc ctggattgag
    2501  ggcgtcacaa agtctcaagc ctctgtgatg acgcagttta agctttcccc
    2551  cttcctcatg cgtgacattg ttcgtgatga cggtgcaata ccactatcac
    2601  tccacaagat actcaaggac tacacgcacc gcaacactga tctgatagga
    2651  acaaaactct ccgtcatgtc gcatatctac aactcgtggc ctctctaccg
    2701  gacagtgcac caatccattt ttcgtggaga ttctaatgtt ccgcaaacgc
    2751  tcagatacgc acgcgttcct ttcaacgtca gcactgccca tgattttcca
    2801  tgggaagatt tcgcacaggc atgccttgag ttccagccac gtgttcttca
    2851  ggtcttcagt gacaacagca gcacttcgcg cataatcaac ctacagattg
    2901  gcaagatgca catcgtcaat tccatggaag aagtcaagat aaacatacac
    2951  agctaccagc gctctgcaga aaacctacgc tcagtcaaag acagctttga
    3001  gagctcgatc tttcgaacaa aactgcttcg tgggaaccca actggaaaga
    3051  taaccaagcg cattgagact ctccttgata acgtgcgggt gctacaacag
    3101  gtgcacgcaa aactagagat gattgcatac tcaggtggag agaaagttaa
    3151  catggacaag aaatcagttg acgaactcaa tgagatcgtc gaactccaga
    3201  gcaagaattc actcactgcc gaagaactag cacgcatatt gcaccttacg
    3251  aagcccacct ccactttctt caatcttttt gctgaacgcg gccgacaaat
    3301  gctcgtcact ctcctggtca tggttgccgc ctcgctcatg tatcttgttt
    3351  tctgggtttc cccaaggaaa caagacgaca tcaccattga aggaaaaggt
    3401  agagcataca atcgtgacaa gcgcatgggg tacgactcct acgaagagga
    3451  cgaggttcgc aacaagatca acaagaagtt caaagaacgc agcacaaggt
    3501  tctccaacga ttccaaaccg gaaacaaact caaaataccg gaatctgaag
    3551  caagagtttg ttaatttcta tgatcttaag actgatgcga acgtactaca
    3601  agctgtgttc actgcaatgg acggagccgt tcttcttcaa accgaatcgc
    3651  caatggcaga tattggccgt gtcaatagac tgctgcaaga ccactttgga
    3701  gatagtgaga gccgagccgt gcatgaaggt ctcaacacca tggttaagtg
    3751  ccacttaact atgaaagatg gaagacagtt tgagctcgac atggaacagc
    3801  atgatcccga gtatgttgcc aaacttggag gtgaagttgg tttcagaatg
    3851  aacagagatg atctacgcca agttggtgcc acacggtaca tcaacccaag
    3901  agcacaaaca tccgcagcga ctctcgaagg catgaccatg aaacccatga
    3951  gttctttcac cattgatagc gcaaagatgg ttggcttcat caagactgca
    4001  aaagacacac tcaactgcat cctctatggc gactggatca tagctcctgc
    4051  gcacatacaa cagggcgaag gggacataac attcatcttt cagcacatac
    4101  agttcacgac cacaactgag cgcttagcca gctacggcat ccgacaattt
    4151  aaaggccttg accttgttgt catccgacgc ccccaacaga tacgcgcggt
    4201  taagaaggac atgcgcgcta gcattcttga cacacctact gagatacaga
    4251  tgctatattt gtcagtaaaa ggtggcaagt accaagtgtc cacgtccgct
    4301  gtgtgctttc cacactacaa caaccgatgg ggacatgtta tttcaacggc
    4351  tgaaggtatg tgcggctgca ttgtatttga ccccaccact aatcacattg
    4401  ttggaatcca cgtctcctac aacgacacgc gcagaagaaa cgagtttcag
    4451  gctttcacga gcgacgttct gacaacgatt aatgcgcctg gacacgaaat
    4501  acctttcagc ccgtgggtct ttgactggaa gttttgcggg tacacgacaa
    4551  aaccacggaa catgcaaagc gcaccgagca cgcttgagag actcaacatc
    4601  aacgccacag gttttggttt caagctcaac gcacaggaga tcaaacctgc
    4651  catgctccgc tccacagagt cgttctccag ggagtttcca aacacacagt
    4701  tcaaacttat cggcgaagtg aagaaaggac tcatcgacaa acacacgatt
    4751  acaggagaga atccctactt ccttgaattc ctggacacat tcaaaccata
    4801  tcaatgggta caggccttca tggacgagta cgcaccctcc atccttgcct
    4851  atgatgcgta tttcaaggac ttgaagaaat acgataggcc accacatgca
    4901  aatgctttct gccagaacac attaaccaaa gctaaaaaca agatgatcaa
    4951  cattctcgaa gaggcaggca tgggaaggac cctagtacga accaccgagc
    5001  aagtcttgct tgacatggcg tggaccacct ctggtggacc attataccat
    5051  ggtaagaaga ttgacattgt gcaacacttg tctgatgacg agcttgtgca
    5101  attcagtgaa gcctgccaac aggctctcat cactggaacg ctggatggag
    5151  tctggaacgg atcactcaaa gccgaactgc gctcttcgca gaaaatcctt
    5201  gaacggaaaa ctcgtgtttt cactgctgcc cccatcacaa gcctaatcgc
    5251  aatgaaatat tacgtggatg atttcaacaa gcagttctac aaaacccacc
    5301  tcaaagcacc acacacagtc ggcatcaaca agtttaaccg cggatggcag
    5351  aatctctatg agaagctcaa caaacctggg tggacgcatg ggagcgggga
    5401  cggctccagg ttcgatagct ctattgacgg attccttttt gacgtcatca
    5451  aagacatccg gaagcacttc atggacgcag aacaccacaa ggagctagac
    5501  acaatttatg aagagattgt caacacaaaa atatgtctag caaatggtct
    5551  catcatccaa aagaactgtg ggaacaacag cgggcagcca agtactgttg
    5601  tagacaacac acttgcactc atgactgctt tcctctacgc atacgtccgg
    5651  ctcactggag accacgcctt cgaactcatg gacgaaaact ttgttttcgt
    5701  ttgcaatggt gacgacaaca agttcgctat gtcacctagc ttcatgacaa
    5751  agtttggatg cgacttctca ccattccttt ctgagctagg gctaacctac
    5801  gaattcgacg aagccactga agacatttgt gaaaacccct acatgtcctt
    5851  gacgatggtc cgcacctcgt ttgggatcgg tttctccctc tccatagagc
    5901  gcatcgttgc aatcttgcaa tggagccgcg ctggcggagt cctgcatgcc
    5951  tacctctctg gcattgccgc tcttttcgaa tccttcaaca cacccaagct
    6001  ctttaatctc gtgcacacat acctcctctg gctcatcaca gagcacgagg
    6051  aggaactctt ctctatgatg gaactcagag acatgttcat gcccctgccc
    6101  actaaggaac agatagcctt gttgcactac gtcgggactg agcccatcgt
    6151  ggaggagact ttcctgcaag cagggcatga ggaaccagat cccatagttc
    6201  caccagcctc cgacaccgat ctgacaaaca tggctgcagc accaccggac
    6251  aacagaaggt cacgtgccgt catcccccgt ggcactagtg attggagcat
    6301  gcccgaaccc acaatgcgaa cactgggttt taagtccaag atcaaaatcg
    6351  aaacacttgc tgatgtcccc gaagggtata tgaatacctt tgcgtccgtt
    6401  gcaactgagt cgcaacgtag gaagtgggaa gaggccacgc gtggcgattt
    6451  tggcattacc gacgacgaga aatgggaaaa attgctcatt gctgcctgta
    6501  tatactttgc agacaatggc acctcaccaa attttgatga ggaactcact
    6551  atggaagtta atggcggtct caactccatc aaagagtatc ccgttcgccc
    6601  tttcgtcgtc agggccaaga agatctccac actgcgcagg atcttccgct
    6651  gttactccat cgaaacgaaa ctgatgtttg taaagctgag gcgcgtgccg
    6701  cattgggcca taaagcacgg atgccttgat gaaatcgtct ttgatttcat
    6751  gatccccgac cagttcacct ccaggactgc actggaaaca ctgaagcaga
    6801  ccaagcttgc cgccattggt gttggcacaa gcaattctct tctcacctct
    6851  gagcagacga acatgaggac cactgaaacc cggaggcgca atgactacga
    6901  tggtcacgag gcgcttctcc ggtagatctc tcatgcagtt tcayttcctt
    6951  tcaagcagtg catttaaata cgcttttaat tacatcaagc gtcaagaatt
    7001  cctcccgctt gcagcgaatc cttaaagggt ggcactttgt gttatgcaat
    7051  ggaaaattca gtgacgcaat caaccatcat tggttggtga caacgcagta
    7101  ctttctttct ttcacatcaa gcgaccagca catcgcccgc ttacagctaa
    7151  tcctacctga gggtggcact ctgtgttatg taatggaatg tgctatctcg
    7201  caaccaaccg tcattggttg atggtgcggc taacacccgc gctcttgtat
    7251  accggaaagg tt