!!NA_SEQUENCE 1.0
ID   BYE132268  standard; RNA; VRL; 7637 BP.
XX
AC   AJ132268;
XX
SV   AJ132268.1
XX
DT   28-JAN-1999 (Rel. 58, Created)
DT   28-JAN-2003 (Rel. 74, Last updated, Version 5)
XX
DE   Barley yellow mosaic virus, Chinese (Yancheng) genomic segment RNA1
DE   complete sequence
XX
KW   14 kDa protein; 7 kDa protein; coat protein; cylindrical inclusion protein;
KW   NIa-Pro protease; NIa-Vpg protein; P3 protein; polyprotein.
XX
OS   Barley yellow mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Bymovirus.
XX
RN   [1]
RP   1-7637
RA   Adams M.J.;
RT   ;
RL   Submitted (27-JAN-1999) to the EMBL/GenBank/DDBJ databases.
RL   Adams M.J., Crop and Disease Management, IACR-Rothamsted, Harpenden, Herts,
RL   AL5 2JQ, UK.
XX
RN   [2]
RA   Chen J., Shi N., Chen Y., Diao A., Chen D., Wilson M.A., Antoniw J.F.,
RA   Adams M.J.;
RT   "Molecular analysis of barley yellow mosaic virus isolates from China";
RL   Virus Res. 64:13-21(1999).
XX
DR   GOA; Q9YJW3; Q9YJW3.
DR   SPTREMBL; Q9YJW3; Q9YJW3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .7637
FT                   /country="China"
FT                   /db_xref="taxon:12465"
FT                   /virion
FT                   /organism="Barley yellow mosaic virus"
FT                   /isolate="Yancheng"
FT                   /specific_host="barley"
FT                   /segment="RNA1"
FT   5'UTR           1. .171
FT   CDS             172. .7404
FT                   /db_xref="GOA:Q9YJW3"
FT                   /db_xref="SPTREMBL:Q9YJW3"
FT                   /product="polyprotein"
FT                   /protein_id="CAA10637.1"
FT                   /translation="MEQTLAQAVSRRNKTDTPMAEERKHFSPMNFSANFVAPELFYSAN
FT                   VRKIKNIFKERSTTRFLDAISSDFELVAFLTLSPAHLMQLETVLRQEMRSCAVPIVTSD
FT                   ASFETVAVIKTALDGMRFHFGYTTLEKGWISMMRHAESCLQESSSSAVNDLQTPIKRVG
FT                   SLLLSGKNRVEGCELSVLNLTARRFRIEYGLNGTYFGEHVAMLRDLKRYIYGTVPKEFL
FT                   WAKTKKHLPFTIPAWITRTPIDCFLFCLRVIPILHRFGVAMSLIYFSCVAALNFPAFMG
FT                   FLFKRQFAKYLAHSFAKHSIYFMFLTIVAILWSFRTFTSQKPKIVLQARSTAEKEKKLM
FT                   MILASVVGITYLFDYDIAEALGNCLHKISRLSSYLLDDHQGIASRMFGASYGLQAGDSA
FT                   EDAVTTIISDLLSVTFKIVDEDASQGTVEDASETTFHSWVGVNTLAGRNMSRPLQYSVN
FT                   KTYALTPQNVQLQARAMADANNCWSMVVGHTGSGKSTYLPVQYSNYLSTKSDRRQQILI
FT                   CEPTQAATENVCAGVAANLGRAVYGRHEGWSRMGDHCIQVMTYGSALQCHAMDPSFIST
FT                   FDAIFLDEAHDVKEHSLVFESICDTFKSVRKFYVSATPRDGSVCPEAARKYPLHVETSV
FT                   CDSYRKFIAAQGGGDLLDISKHDTALVFLAGRPECIKAANAWNASVTGEKRAFSLSSDN
FT                   FATDFSMLTERLKTHKTIIFTTNIIETGVTLSVDCVVDFGHTMRPCLDLNQKSLRLDRR
FT                   KVTRNERQQRIGPTGRLKDGYAIVCGDVDRAVNVISPDVLYGAALLSFKHNVPFYMNET
FT                   FESSWLKGVTKAQADTMTIFKLPIFLTRDLINADGSVAKEFLDVLKKHQFTTSDIKQAP
FT                   SITAKHIFPTWASYFSLHQALHYGDDKDEIPHELRYARVPFSVTTLSKFDWPALALACE
FT                   KHRASMSNVFAGIEEPARVVTLQTNPANIQASITHLMHMSKNYKTLIENNQHVRQSMMT
FT                   NVMYKWFSSTRITKDLDRNLRRCTDNLAVVEATLSSLRQILAGNTQVHATPHMQSTLED
FT                   IIGLQASDTLTEESLASALGIFVPKSNLFLLLATKGFKLVYVICILLLVNLVYIGLRKW
FT                   REHLKQKGSDEILTNTMPVSEGGEILAEVMKMEPKMRKNIKRDMDEAVESKLCGFTFVF
FT                   PDDDKIGLEGKGNKYRPREDARLMYSTREDATFDAWNEKAKERRKKVTDKSEPELRRAY
FT                   EKRPYFNFYDLQTDSNILEAIFYTTEGDEFFRTADPNKDMNLVADKLRSFLDTKLVVGH
FT                   HQRKLLEETAQVVIKDTKGTAHKMEISQHDPDCLKQNGSGKVGYPEHRGQFRQEGVAIT
FT                   SDYDLGVEFGTDTDNITLEASTGILLSQVGVDVATRVGRISIGTFNMNCYFYNDWILVP
FT                   GHLQDRSGNVTIQFPDQTVQTTTDALNANGVKRFYGLDVIAIRRPAILRPRTKLVKAFA
FT                   IEEPVIAQMVFVDAQGVRKFTQSDWARKGENSGRWSHKISTVLGMCGCQFWTLERQIDG
FT                   IHVATNYTKKRNEFQPFTQEVVDFINGPGTKIPYCPWVFDRPACGYASHTALFEKPTTL
FT                   TDVIHMQASDGLHNINNAIEGFGSSLRGQLVSPPTESTRQRFDKLFGSGSFELIGQMNK
FT                   GLIDKHVIVGENDDVYDFMREHPTFTWLKDFMNEYAPSVLSYSAYYKDLCKYNRAKHVL
FT                   TYNPEELHYATKGLIKMLEDAGLTQGSVRTPQQVISDIQWNTSAGPSYQGKKRDLCAHL
FT                   SDDEVLHLAEVCRQQFLEGKSTGVWNGSLKAELRTIEKVEPEKTRVFTASPITSLFAMK
FT                   FYVDDFNKKFYATNLKAPHTVGINKFGRGWERLHDKLNRPGWLHGSGDGSRFDSSIDPF
FT                   FFDVVKTIRKHFLPSEHHKAIDLIYDEILNTTICLANGMVIKKNVGTQRQPSTVVDNTL
FT                   VLMTAFLYAYIHKTGDRELALLNERFIFVCNGDDNKFAISPQFDEEFGHDFSPELVELG
FT                   LTYEFDDITSDICENPYMSLTMVKTPFGVGFSLPVERIIAIMQWSKKGGVLHSYLAGIS
FT                   AIYESFNTPKLFKSIYAYLLWLTEEHEAEILAAMTQSSTALPIPSMLDVYRLHYGDDEI
FT                   WLQAADPLTDAQKEAAHTAAADRARLDLADADRRRKVEADRVEAARVKKAADAALKPVN
FT                   LTATRMPTEDDGKLKTPSGARIPSSAADGNWSVPATKQVNAGLTLKIPLNKLKSVPKSV
FT                   MEHNNSVALESELKAWTDAVRTSLGITTDEAWIDALIPFIGWCCNNGTSDKHAENQVMQ
FT                   IDSGKGAVTEMSLSPFIVHARMNGGLRRIMRNYSDETVLLITNNKLVAHWSMKHGASAN
FT                   AKYAFDFFVPRSWMNPQDIEVSKQARLAALGTGTYNTMLTSDTTNLRKTTNHRVLDSDG
FT                   HPELT"
FT   mat_peptide     172. .1155
FT                   /product="P3 protein"
FT   mat_peptide     1156. .1353
FT                   /product="7 kDa protein"
FT   mat_peptide     1354. .3330
FT                   /product="cylindrical inclusion protein"
FT   mat_peptide     3331. .3696
FT                   /product="14 kDa protein"
FT   mat_peptide     3697. .4257
FT                   /product="NIa-VPg protein"
FT   mat_peptide     4258. .4929
FT                   /product="NIa-Pro protease"
FT   mat_peptide     4930. .6510
FT                   /product="NIb polymerase"
FT   mat_peptide     6511. .7401
FT                   /product="coat protein"
FT   3'UTR           7405. .7637
XX
SQ   Sequence 7637 BP; 2151 A; 1797 C; 1699 G; 1990 T; 0 other;

AJ132268  Length: 7637  February 4, 2003 13:32  Type: N  Check: 3078  ..
       1  aaaataaaac aaccctaaac caaacaaaac aaaacaaaac aaacacaaac
      51  aacacacgct ccccaagctc attacatttg tagagtgatc tttgtcatcc
     101  tactctttgt gagcttttcc gcaaatcaac ctgcttgctt ttgcgccccc
     151  ttcaccttca ctctcgctcc catggagcaa accctagctc aagctgtgtc
     201  acggagaaac aaaacagaca cacctatggc agaagagcgg aaacatttca
     251  gccccatgaa tttttccgca aactttgttg ctcctgagct cttttatagt
     301  gctaatgtga ggaaaatcaa aaatatcttc aaagagcgca gcacaactcg
     351  gtttctggac gcgatttcaa gtgactttga gcttgtcgct tttctcacct
     401  tgagtcctgc tcatttaatg caacttgaaa cagttctgcg ccaagagatg
     451  cgttcgtgcg ctgtgccaat tgtcacctct gatgctagct ttgaaacagt
     501  tgctgtcatc aaaaccgctc tggatggcat gagatttcac tttggataca
     551  ctactcttga aaaggggtgg atatctatga tgcgccatgc ggagagttgc
     601  ctgcaagaga gctcttcttc ggctgtgaat gatctgcaga cgccaattaa
     651  acgtgttgga tcactgctcc tgagtggaaa aaatcgcgta gaaggctgcg
     701  aactatctgt cttgaacctc accgcgcgac gtttcaggat cgaatatggg
     751  ctaaatggta catactttgg cgaacatgtt gctatgctac gcgacttaaa
     801  acgttatatc tatggtaccg taccaaaaga gtttttgtgg gcgaaaacca
     851  aaaagcactt accgttcaca atccccgcgt ggatcacgcg tacgcccatc
     901  gactgtttct tgttctgtct tcgcgttatc cctatcttac ataggtttgg
     951  tgttgccatg tcacttattt acttttcgtg tgttgccgct ttaaattttc
    1001  ctgcttttat gggtttctta tttaagcgtc agttcgctaa gtatttagct
    1051  cactcttttg ctaaacactc catctacttt atgtttttaa ctatagttgc
    1101  tattttatgg tctttccgca cttttacttc tcaaaaacca aaaatagtgc
    1151  ttcaggctag gagcacagca gaaaaagaga aaaagcttat gatgattcta
    1201  gctagtgtcg ttgggatcac ttacctcttc gactacgaca tagcagaagc
    1251  tcttgggaat tgtctacata aaataagccg tctgtcctca tatcttctcg
    1301  acgaccatca aggcattgca tcacgaatgt ttggagcaag ctacgggctt
    1351  caggctggcg acagtgctga ggatgcagtc acaacgataa tcagcgactt
    1401  actgtctgtt acttttaaaa ttgtggatga agacgcatcg cagggcaccg
    1451  tggaggacgc atctgagaca accttccaca gttgggttgg tgttaacaca
    1501  cttgcaggcc gcaatatgtc aagaccactc cagtatagcg tcaataaaac
    1551  gtatgcactc acacctcaaa atgtccagct ccaagcgcga gctatggcag
    1601  acgctaacaa ctgctggtca atggttgttg gtcatacagg atctggaaag
    1651  tccacatact tacctgtgca gtactccaac tacttgtcca ctaagagtga
    1701  taggcgacag caaattctta tctgcgagcc aactcaggct gccactgaga
    1751  atgtttgcgc tggcgtcgct gccaatcttg gcagagctgt ttatgggcgc
    1801  catgagggtt ggtccagaat gggggatcat tgcattcaag ttatgacgta
    1851  tggttctgcg ctccagtgtc acgccatgga ccccagcttc atatcaactt
    1901  tcgacgcaat ttttcttgat gaagcacacg acgttaaaga gcactctcta
    1951  gtctttgaga gcatttgtga cacattcaaa tccgttcgaa agttctatgt
    2001  ttcagcaact cccagagatg gcagtgtttg tcctgaagca gctaggaaat
    2051  atcctttaca tgttgaaact agcgtttgcg attcgtatcg gaagttcatt
    2101  gcagctcaag gcgggggaga tttgttggac atctcaaaac atgacacagc
    2151  tttagttttt ctagcgggac ggcccgagtg tattaaagct gctaatgcct
    2201  ggaacgctag tgtcactggt gagaagcgcg ccttttcctt gtcgagcgac
    2251  aactttgcta ctgacttctc aatgctaact gagaggctca aaacacacaa
    2301  aaccatcatc ttcaccacga acataattga aacaggtgtt actctcagcg
    2351  ttgactgtgt tgtggatttc ggccacacaa tgcgcccatg tttagatctc
    2401  aatcaaaaat cattgcgtct tgatcgacgc aaagtgacgc ggaacgaaag
    2451  acagcagaga attgggccaa caggtcggct caaagatgga tacgccatag
    2501  tgtgtggaga tgttgataga gctgtgaacg tcatctctcc tgatgttctt
    2551  tatggagctg ctcttctgag ttttaaacac aatgtgcctt tctacatgaa
    2601  cgagacattt gagagttcct ggttgaaggg tgttacaaag gcacaagcag
    2651  acacaatgac aatcttcaag cttcccatat ttctaacacg agatctcatc
    2701  aatgcagatg gctcagttgc taaggagttt ctcgatgtcc taaagaagca
    2751  tcaattcaca acaagcgaca taaagcaagc accaagtatc acagccaaac
    2801  atatcttccc aacttgggct tcatacttct ctctccacca agcacttcat
    2851  tatggtgatg acaaggatga gataccacac gaattgcgat atgcgcgtgt
    2901  tcccttctcc gtcacaactt tgagcaaatt cgattggcct gccttagctc
    2951  ttgcatgtga gaaacataga gcttccatgt caaatgtgtt tgctggcatc
    3001  gaggaacctg cacgcgttgt cactctacaa acaaatcctg cgaacatcca
    3051  agcgagcatc acacatttaa tgcacatgag taagaactac aaaactctta
    3101  ttgaaaataa tcagcacgtg cgccaatcca tgatgacgaa tgtcatgtat
    3151  aagtggttct cttccactcg catcactaaa gatcttgata gaaacttgcg
    3201  aagatgcacg gataaccttg cagttgtcga ggccacgctc agctcactta
    3251  gacaaatctt agctggcaac acgcaggttc atgcaacgcc acacatgcag
    3301  agcacccttg aggatattat tgggctccaa gctagcgaca cacttacgga
    3351  agagagctta gcaagcgcac ttggcatctt tgttccgaag agcaacctct
    3401  ttctgctgct agctaccaaa ggttttaaac ttgtgtacgt tatctgcatc
    3451  ttacttcttg tgaaccttgt ttatattggt cttcgcaagt ggcgcgaaca
    3501  tcttaagcag aaaggaagcg atgaaatcct aactaacaca atgccagtta
    3551  gcgaaggggg ggaaattctc gccgaggtca tgaaaatgga gcccaaaatg
    3601  agaaagaaca tcaagaggga tatggatgaa gccgttgaga gcaaactatg
    3651  tggtttcacc tttgtttttc cagatgatga caaaattggt cttgaaggta
    3701  agggaaacaa gtaccgccct cgcgaagatg ctcgtctcat gtactccact
    3751  agggaagacg ccacctttga cgcttggaat gagaaagcaa aggaaaggcg
    3801  taagaaggtc accgacaaat ctgagccaga gcttcgcaga gcctatgaaa
    3851  agagaccgta cttcaatttc tacgaccttc aaacagatag caacattctg
    3901  gaagccattt tctacaccac tgaaggcgat gagtttttcc gaacagcaga
    3951  tcccaataag gacatgaact tggttgctga caaactgcgc tcttttctcg
    4001  acacaaagct tgttgttgga caccaccagc ggaagctact agaagaaaca
    4051  gctcaggttg ttatcaaaga tacgaaggga actgcacaca agatggagat
    4101  ttcacagcat gatccagact gtctaaagca gaatgggtcc ggcaaagttg
    4151  gatatccaga acaccggggg cagtttcggc aggaaggagt tgccatcaca
    4201  tcggattacg atcttggagt tgagtttggc accgataccg ataacatcac
    4251  gcttgaagcc tctactggga tattattgtc acaagtcggg gtcgacgtcg
    4301  caactcgagt tggaagaatt agcattggta ctttcaacat gaactgttac
    4351  ttctacaacg actggattct ggttccggga cacctgcaag acagatccgg
    4401  caacgtaaca attcaatttc ctgatcaaac agtgcaaacc acaactgatg
    4451  cactcaacgc aaatggtgtg aaacgattct atggattaga tgtgatagca
    4501  attcggcgcc ctgctatctt gagacctcgc accaagttgg tcaaagcttt
    4551  tgctattgag gaaccggtta tcgcacaaat ggtctttgtt gacgcacagg
    4601  gagttcgtaa gtttacacaa tctgattggg ccagaaaggg ggagaattcc
    4651  gggcgttggt cgcacaagat ttccactgtt cttggcatgt gtggatgcca
    4701  gttttggacg ttggaaagac agattgatgg aatccatgtt gccacaaact
    4751  acacaaagaa gcgcaacgag ttccaaccct tcactcagga ggtcgttgat
    4801  tttataaatg gacctggaac aaagatcccc tactgcccat gggtattcga
    4851  tagaccggct tgtgggtatg catcccacac agctttgttc gagaaaccaa
    4901  ccacactaac tgacgtcatt cacatgcaag cttctgatgg tttgcacaac
    4951  atcaacaatg ccattgaggg ttttgggagc tcactgaggg gtcagctcgt
    5001  gtcaccaccc actgaatcca ccaggcaacg tttcgataag ctgtttggta
    5051  gtggcagctt tgagctcatt gggcaaatga acaaaggctt aatcgacaag
    5101  cacgtgattg ttggggaaaa tgatgatgtt tacgacttca tgcgtgagca
    5151  cccaacattt acttggttga aagatttcat gaatgagtat gcgcctagtg
    5201  ttttgtctta ctctgcttac tacaaagatc tttgcaagta taatcgtgca
    5251  aaacacgtgc tcacttacaa cccagaagag ctccattatg cgacgaaagg
    5301  actgatcaag atgttggaag acgctggctt gacacaaggc agtgtgagga
    5351  caccccaaca agtcatttcg gacattcaat ggaacacttc cgctggaccg
    5401  agctatcaag gaaagaaacg cgacctctgt gcccatttga gtgatgatga
    5451  ggtgctgcat ctcgctgagg tgtgtcgcca acaatttctc gagggcaagt
    5501  caaccggagt atggaatggt tctttgaaag ctgagttgag aaccatcgag
    5551  aaagttgagc cggagaaaac gcgtgttttc acagcctctc ccataacaag
    5601  cttgtttgct atgaaattct acgttgatga ttttaacaag aagttctacg
    5651  ctaccaatct gaaagccccc catactgttg gcatcaataa gttcggtagg
    5701  ggatgggaaa gattgcatga taagcttaat cgccctggat ggttgcacgg
    5751  cagtggagat ggttctaggt tcgacagctc tatcgatcct ttcttcttcg
    5801  acgttgtgaa aactattcgc aagcactttc tcccttctga gcatcacaaa
    5851  gccattgatc tcatatatga tgagattctc aacacaacca tctgcctagc
    5901  taatgggatg gtcatcaaga agaatgttgg aacacagcgg cagcctagca
    5951  ctgttgtcga taacacactt gtgcttatga ctgcatttct ctacgcatac
    6001  attcacaaaa caggagaccg cgaattggcc ttgctaaacg agcgtttcat
    6051  ctttgtttgc aatggcgatg acaacaagtt tgccatatct ccacagtttg
    6101  acgaagagtt tgggcatgat ttttccccag aacttgttga acttggactc
    6151  acgtacgaat ttgatgacat cactagcgac atttgcgaga atccttatat
    6201  gtccctcacc atggtgaaaa ccccttttgg cgttggtttt tctcttcccg
    6251  tggaaagaat catagccatc atgcaatggt ccaagaaagg gggagttctg
    6301  cactcatatt tggctggcat ttccgcaatt tacgagtcct tcaacacacc
    6351  aaaacttttc aaatcaatct atgcatatct tctttggctc actgaggagc
    6401  acgaagcaga aattctcgca gccatgactc aatcctcaac tgctcttccc
    6451  ataccatcaa tgctcgatgt ttatcggttg cattatggtg atgatgaaat
    6501  ttggctacaa gctgctgacc ctctcactga tgcgcaaaaa gaagctgcac
    6551  acactgctgc agctgataga gcacgcctcg acctagccga tgctgatcgt
    6601  agacgtaaag ttgaggccga ccgtgtggaa gcggcaagag tcaaaaaggc
    6651  agctgatgct gcactaaaac cagttaacct cacagcaaca cgcatgccca
    6701  cagaagatga tggcaaactt aaaacaccat ctggcgctag aataccatca
    6751  tcagctgcag atggtaactg gagcgtgcca gcaacgaagc aagttaacgc
    6801  tggtttgaca cttaaaattc ccctgaataa gctcaaaagt gtacccaagt
    6851  ctgttatgga gcataacaac tcagttgcac tcgaatctga gctaaaagcc
    6901  tggactgatg ctgtgcgcac aagtttaggt atcacaactg atgaggcatg
    6951  gatcgatgcc ctcattccct tcatcggatg gtgctgcaat aatggcacct
    7001  cagacaagca tgctgagaat caagtaatgc aaattgacag cggaaaggga
    7051  gctgtcacag agatgagtct gtccccattt attgttcatg ctcgaatgaa
    7101  tggtggactc cgaaggatca tgcgcaacta cagtgatgaa accgtcttac
    7151  tcatcacaaa caacaaacta gttgcacatt ggtcaatgaa gcatggcgct
    7201  tctgcaaacg caaaatacgc tttcgatttc ttcgtcccac gatcatggat
    7251  gaacccacag gatatcgaag tgtcaaagca agcgcgctta gcagcacttg
    7301  gaactggaac gtataacacc atgttaactt ccgacactac caatctgcgt
    7351  aagacaacca accacagggt tctggactca gatggacacc cagaactaac
    7401  ctaaaccatc accccgtgcc ttatacatca cccacccccg ctcataattc
    7451  agtctttaaa ttatgttcgt gacgtctttg tatcaggctc ggaacggttc
    7501  tatgatccat atgcctttgg cagttacaat gtcagcattc tcattgagga
    7551  gtatgacagc gtttgatcag ccgttttcaa tcatccgtcg ttggatggtg
    7601  gtgcacttag tgcacttacg agtaccagaa ggtaatg