!!NA_SEQUENCE 1.0
ID   BYE132269  standard; RNA; VRL; 3582 BP.
XX
AC   AJ132269;
XX
SV   AJ132269.1
XX
DT   28-JAN-1999 (Rel. 58, Created)
DT   28-JAN-2003 (Rel. 74, Last updated, Version 5)
XX
DE   Barley yellow mosaic virus, Chinese (Yancheng) genomic segment RNA2
DE   complete sequence
XX
KW   P1 protein; P2 protein; polyprotein.
XX
OS   Barley yellow mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Bymovirus.
XX
RN   [1]
RP   1-3582
RA   Adams M.J.;
RT   ;
RL   Submitted (27-JAN-1999) to the EMBL/GenBank/DDBJ databases.
RL   Adams M.J., Crop and Disease Management, IACR-Rothamsted, Harpenden, Herts,
RL   AL5 2JQ, UK.
XX
RN   [2]
RA   Chen J., Shi N., Chen J., Adams M.J.;
RT   "Molecular analysis of barley yellow mosaic virus isolates from China";
RL   Unpublished.
XX
RN   [3]
RA   Chen J., Shi N., Chen Y., Diao A., Chen D., Wilson M.A., Antoniw J.F.,
RA   Adams M.J.;
RT   "Molecular analysis of barley yellow mosaic virus isolates from China";
RL   Virus Res. 64:13-21(1999).
XX
DR   SPTREMBL; Q9YJW2; Q9YJW2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3582
FT                   /country="China"
FT                   /db_xref="taxon:12465"
FT                   /virion
FT                   /organism="Barley yellow mosaic virus"
FT                   /isolate="Yancheng"
FT                   /specific_host="barley"
FT                   /segment="RNA2"
FT   5'UTR           1. .154
FT   CDS             155. .2827
FT                   /db_xref="SPTREMBL:Q9YJW2"
FT                   /product="polyprotein"
FT                   /protein_id="CAA10638.1"
FT                   /translation="MSASSSRLLFDCGSLDWPNKSLFGDPTTRDVMNEHISSTWNAVIR
FT                   RHMLAPNANAETILGRDGLPSAQFDAYGAMLPSFIQALNAPTTRLRISAPLSTAESILC
FT                   ADASHAPWLYMANSVCAYEATHLQPVQTFIAFNFAHGYCYLSLFIPLSFRITFENARGF
FT                   SRFLEQLPDILGAYPTLAAIYKTMLFAIRLFPEVLQAPIPIIAKRPGVLQFHVSDARGL
FT                   PPSWFPMKCGSVASFVALITNNLNSDLLNGIVGSNGDGEHYTNWNSGHDHWIVNRFITV
FT                   KDLHSSLKSALEVDLDTEGGRNAVLDLLLDLGVTNLVRREKRFPAYFQGAESVYLLLSC
FT                   ERVGNELVAVQDALQEPLANYSGLDLRALIINLGGLPSRHSDICYTRNIFENDNHLVWN
FT                   FEFYRIASITKNAQIDRDVLSSSMANLFSDFVSESSNGQYRVKEPRPVVQYRVEHDEPV
FT                   ASSAPSAWWQVLIGITTAILGAIIFFLWRCFLRAKRVKFQAKDSFPWFTTSGDDDSPPP
FT                   PGDSPSRPPGRSPDRVLPRTVVRDLSFNDDDDLHSVDLNEAGSRFGEVVSLIARGNLRE
FT                   LAGAIPESLSNLTLLQTSASGSGFYTMVALYLATLGDAITAFHEHNDASPATIQSLRTL
FT                   ELQLEARGLRFNEAGTPANLIQRGVNSSVGRALVRLTQSALLATGENFRTRMATTLERI
FT                   AAERLNTLTAYDQRVIEMTTELLAAIKPVLEVERSELTPHLANAEALLQVYNNLFSTDY
FT                   VSASLLALRREMILRSAEGRVGEQPTSASDAANEELVQRSMTKLDKEIELFQAQIDSQR
FT                   RAVTITEASNLRENILQPINTVANIAMAGAFLRGGARHRMPGMPDVATPMPNPFRAFSG
FT                   RGHSLTTTRSGGLFRRPRV"
FT   mat_peptide     155. .919
FT                   /product="P1 protein"
FT   mat_peptide     920. .2824
FT                   /product="P2 protein"
FT   3'UTR           2828. .3582
XX
SQ   Sequence 3582 BP; 922 A; 918 C; 778 G; 964 T; 0 other;

AJ132269  Length: 3582  February 4, 2003 13:32  Type: N  Check: 6379  ..
       1  aaaataaaac aaccctaaac caaacaaaac aaaacaaaac aaacacaaac
      51  atcacacgct ccccaagctc acaatacttg tagagtgatt tctgtcatcc
     101  tactgtttgc aagctttcca acaaatcaac ccgctcgctt tcaaaccctc
     151  catcatgtct gcttctagtt cacgcttact cttcgactgt ggcagtcttg
     201  actggccaaa taagagctta tttggcgatc ccacaacgcg agatgtcatg
     251  aacgaacaca tttccagcac gtggaatgcg gttattagaa ggcacatgtt
     301  ggcgcccaat gccaacgccg agactatatt gggccgtgat ggtttgccat
     351  ctgctcaatt tgacgcgtat ggagccatgc tacccagctt cattcaagct
     401  ctaaatgcac ctacaacgcg tctccgaatc agcgcaccgc tgtccaccgc
     451  tgagtccatc ttgtgcgctg atgcatccca cgccccttgg ttgtacatgg
     501  caaacagtgt gtgcgcatac gaagcaactc atctgcagcc tgtacaaact
     551  ttcatcgctt tcaacttcgc gcatggctat tgttacctca gtctcttcat
     601  accactaagc tttcgcatta ccttcgagaa tgctcgaggt ttcagtcggt
     651  ttctcgagca gcttcctgat attttaggtg cgtatccaac attggctgca
     701  atatataaaa caatgctatt tgctattagg cttttcccag aggtgctaca
     751  agctccaatt cccatcatcg caaaaaggcc tggcgtactc caattccacg
     801  ttagtgatgc cagagggcta ccaccctcat ggttccccat gaagtgtggc
     851  agcgtagcat ctttcgtagc actcatcacc aacaacctga acagcgattt
     901  gcttaatgga attgttggtt caaatggtga tggcgagcac tacacaaatt
     951  ggaactctgg acatgatcac tggattgtga atcgattcat aacagtcaaa
    1001  gatttgcaca gcagcttaaa gtcagctctg gaggttgatt tggacacaga
    1051  gggcgggcga aatgccgttc tcgatttgct tctagatctt ggggttacta
    1101  atctcgttcg aagagagaaa cgcttcccag catactttca aggagctgaa
    1151  agcgtatatc tacttctatc gtgcgagaga gttgggaacg agttagtagc
    1201  cgtgcaagat gccctgcagg aaccattggc taactattct ggcttagatt
    1251  tgagagctct catcatcaat cttggcggtt taccaagcag acactctgat
    1301  atttgctaca cacgcaacat ttttgaaaac gataatcatc tggtttggaa
    1351  ctttgagttc taccggatag cctcaatcac gaagaatgca caaattgaca
    1401  gagacgtgct gagctcatcc atggcgaact tgtttagcga ctttgtttca
    1451  gagtcgtcaa atggtcagta cagagtcaaa gaaccaagac ctgttgttca
    1501  gtacagggtt gagcacgatg aaccagttgc tagtagtgcc ccatctgctt
    1551  ggtggcaagt tcttattggc atcaccactg cgatccttgg cgcaataata
    1601  ttctttctct ggaggtgttt cttacgtgct aagcgtgtga aattccaggc
    1651  aaaggactcc ttcccatggt ttaccacatc tggtgatgat gactcaccgc
    1701  ctccccccgg cgattccccg tcgcgccctc ctggacgcag cccagatcga
    1751  gttcttccgc gcacagttgt tcgagatctt agcttcaatg acgatgatga
    1801  cttacacagc gttgatctca acgaagctgg atcgcgtttt ggggaggttg
    1851  tctctttgat tgcaagggga aatcttcgcg agttagctgg tgcaattcct
    1901  gaatctctca gcaacctaac cctccttcaa acgagtgcaa gtgggtcagg
    1951  tttttatact atggtggctt tgtaccttgc cactttgggg gatgccatca
    2001  ctgcatttca tgagcacaat gatgcctcac ctgccacaat tcaatcactg
    2051  cgaacgctcg aacttcagct tgaagcccgt gggttgcgtt tcaatgaagc
    2101  tggtacaccc gcaaatctta ttcagagggg cgttaattcc tctgttggca
    2151  gagcacttgt gcgactgaca cagagtgctc tcttagctac tggtgagaac
    2201  tttcggacac gcatggcaac cacacttgaa agaattgctg ctgagcgtct
    2251  taacacatta accgcttatg atcagcgagt tattgaaatg acaactgagc
    2301  tcctagcagc gattaaaccg gttcttgagg ttgagcgcag tgaactcact
    2351  ccacatctgg caaacgccga ggctttgctt caagtttaca ataacctctt
    2401  cagcaccgat tacgtttcag catcgctgct cgctcttaga cgcgagatga
    2451  ttctcaggag tgctgaaggg cgtgttggag aacagcccac tagtgcttct
    2501  gacgctgcta atgaggagtt ggttcaacgt tccatgacaa aattggataa
    2551  ggaaatcgag ttgttccagg cacaaattga tagccagcgc cgcgccgtca
    2601  ccataactga agcatccaat ctcagagaaa atatattgca gccaatcaac
    2651  actgtcgcaa atattgctat ggctggagct tttctgcgtg ggggcgcgcg
    2701  tcatcgcatg ccaggaatgc cagacgtagc tacgcccatg cccaaccctt
    2751  ttcgagcttt ctcagggagg ggacattcac tcacgacaac tcgaagtggc
    2801  ggtcttttcc ggcgccctcg agtctagaat tctcatcaca gcagcattta
    2851  ctttccatcg ccttagaata gtttagatca acatcatcca tttctctatc
    2901  ctttcgccat ctgcacacca ttgccattaa tatggtagag ttagcaattc
    2951  atcccttgct acgctcaaaa tctccatctt tagaccacct gcaaacacac
    3001  aaaataccaa aaataccatt tatcattctg tctcaaacgc cagcatttta
    3051  aattacccgc aattgcatta tcgtttcgcc atcaaagtat ggttcgtttc
    3101  atcaacatct gctcgcacga ttgggtgtat ggggccagtg ttgtttcggg
    3151  tatggaattc aaatggtaag aaatttattc ttctcaccat gagtttttca
    3201  ggggataagt tcggtgctac agctagcggc tgtatcctta acgatgcccc
    3251  acaccacgaa acaccattga ttcttcggaa ttagcctttc aaatatccca
    3301  actgcaatga gcacgatagc attgcatctc cactcaaggt ccggttagag
    3351  tccctggcag gtgtgggcta caggagcatg ggaatgcttc tctgtcacca
    3401  tctgtcgtct gcggcctcta tctagcacta cgagtggagc cacgtcttta
    3451  aatccccagc atgtttactt tatgttctgc atagaaaacg tcacatctgt
    3501  gatacaaaaa catgcaacac gtgcccatca tcggtcgcgg gttgtagtct
    3551  gatgaacaac aactttgtac acaggaaatg tg