ID   D01091; SV 1; linear; genomic RNA; STD; VRL; 7632 BP.
XX
AC   D01091;
XX
DT   05-AUG-1992 (Rel. 33, Created)
DT   07-DEC-2007 (Rel. 94, Last updated, Version 5)
XX
DE   Barley yellow mosaic virus RNA 1 for polyprotein, complete cds.
XX
KW   capsid protein; polyprotein; RNA 1.
XX
OS   Barley yellow mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Bymovirus.
XX
RN   [1]
RP   6263-7632
RX   PUBMED; 2584951.
RA   Kashiwazaki S., Hayano Y., Minobe Y., Omura T., Hibino H., Tsuchizaki T.;
RT   "Nucleotide sequence of the capsid protein gene of barley yellow mosaic
RT   virus";
RL   J. Gen. Virol. 70:3015-3023(1989).
XX
RN   [2]
RP   1-7632
RX   PUBMED; 2273381.
RA   Kashiwazaki S., Minobe Y., Omura T., Hibino H.;
RT   "Nucleotide sequence of barley yellow mosaic virus RNA 1: a close
RT   evolutionary relationship with potyviruses";
RL   J. Gen. Virol. 71:2781-2790(1990).
XX
CC   Data kindly submitted in computer readable form by:
CC   Satoshi Kashiwazaki
CC   National Agriculture Research Center
CC   Tsukuba, Ibaraki 305
CC   Japan
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .7632
FT                   /organism="Barley yellow mosaic virus"
FT                   /segment="1"
FT                   /strain="II-1"
FT                   /mol_type="genomic RNA"
FT                   /clone="pBYT10, pBYTS12, pBYTS352, BYTP1-5"
FT                   /db_xref="taxon:12465"
FT   CDS             172. .7404
FT                   /codon_start=1
FT                   /product="polyprotein"
FT                   /db_xref="GOA:Q01206"
FT                   /db_xref="InterPro:IPR001205"
FT                   /db_xref="InterPro:IPR001592"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001730"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR013648"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01206"
FT                   /protein_id="BAA00875.1"
FT                   /translation="MEQTLAQAVSRKSKTDTPMAEERKHFSPMNFSANFVAPELFYSAN
FT                   VRKIKNIFRERSTTRFLDAISSDFELVAFLTLSPAHLMQLETVLRHEMRSCVVPIVTSD
FT                   ASFETVAVIKTALDGMRFHFGYTTLEKGWISMMRHAESCLQESSSSAVNDLQTQIKRVG
FT                   SLLLSGKNRVEGCELSVLNLTARRFRIEYGLNGTYFGEHVAMLRGLKRYIYGTVPKEFL
FT                   WAKTKKHSLFTIPAWIKRTPIDCFLFCLRVIPILHRCGVAVSLIYWSCAAALNFPAFMS
FT                   FLFKRQFAKYLAHSFAKHSIYFMFLTIVAILWSFRTFTSQKPKIVLQARSTAEKEKKLM
FT                   MILASVVGITYLFDYDIAEALGNCLHKISRLSSYLLDDHQGIASRMFGASYGLQAGDSA
FT                   EDAVTTIISDLLSVTFKIVDEDASQGTVEDASETTFHSWVGVNTLAGRNMSRPLQYSVN
FT                   ETYALTPQNVQLQARKMADANNCWSMVVGHTGSGKSTYLPVQYSNYLSTKSDRRQQILI
FT                   CEPTQAATENVCAGVAANLGRAVYGRHEGWSRMGDHCIQVMTYGSALQCHAMDPSFIST
FT                   FDAIFLDEAHDVKEHSLVFESICDTFKSVRKFYVSATPRDGSVCPEAARKYPLHVETSV
FT                   CDSYRKFIAAQGGGDLLDISKHDTALVFLAGRPECIKAANAWNASVTGEKRAFSLSSDN
FT                   FATDFSMLTERLKTHKTIIFTTNIIETGVTLSVDCVVDFGHTMRPCLDLNQKALRLDRR
FT                   RVTRNERQQRIGRAGRLKDGYAIVCGDVDRAVNVISPDVLYGAALLSFKHNVPFYMNET
FT                   FESSWLEGITKAQADTMTIFKLPIFLTRDLINADGSVAKEFLDVLKKHQFTTSDIKQAP
FT                   SVTAKHIFPTWASYFSLHQALHYGDDKDEVPHELRYARVPFSVTTLSKFDWPALALACE
FT                   KHRASMSNVFAGIEEPARVVTLQTNPANIQASITHLTHMSKNYKTLIENNQHVRQSMVT
FT                   NVMYKWFSSTRITKDLDRNLRRCTDNLAVVEATLSSLRQILAGNTQVHATPHMQSTLED
FT                   IIGLQASDTLTEESLASALGIFVPKSNLFLLLATKGFKLVYVVCILLLVNLVYLGLRKW
FT                   REHLKQKGSNEILTNTMPVSEGGEILAEVMKMEPKMRKNIKKDMDAAVESKLCGFTFVF
FT                   PDDDKIGLEGKGNKYRPREDARLMYSTREDATLDAWNEKAKERRKKVTDKSEPELRRAY
FT                   EKRPYFNFYDLQTDSNILEAIFYTTEGDEFFRTADPNKDMNLVADKLRSFLDTKLVVGH
FT                   HQRQMLEETAKVVIKDTKGTAHHMDISQHDPDHLKQNGSGKIGYPEHRGQFRQEGPAKT
FT                   ADYDLGVEFGTDTDDITLEASTGILLSQVGVDVATRVGRIFIGTFNMNCYFYSDWILVP
FT                   GHLQDRSGNVTIQFPDQTVQTTTDALNANGVKRFYGLDVIAIRRPAILRPRTKLVKAFA
FT                   IEEPVIAQMVFVDAQGVRKFTQSVRARKEENSGRWSHKISTVLGMCGCQFWTLERQIDG
FT                   IHVATNYTKKRNEFQPFTQEVVDFINGPGTKIPYCPWVFDRPACGYASHTALFEKPTTL
FT                   TDIIHMQASDGLHNINNAIEGFGSSLRGQLVSPPTESTRQRFDKLFGSGSFELIGQMNK
FT                   GLIDKHVIVGENDDVHDFMREHPTFTWLKDFMNEYAPSVLSYSAYYKDLCKYNRAKHVL
FT                   TYNPEELHYATKGLIKMLEDAGLTQGSVRTPQQVISDIQWNTSAGPSYQGKKRDLCAHL
FT                   SDDEVLHLAEVCRQQFLEGKSTGVWNGSLKAELRTIEKVEAEKTRVFTASPITSLFAMK
FT                   FYVDDFNKKFYATNLKAPHTVGINKFGRGWEKLHDKLNRPGWLHGSGDGSRFDSSIDPL
FT                   FFDVVKTIRKHFLPSEHHKAIDLIYDEILNTTICLANGMVIKKNVGTQRQPSTVVDNTL
FT                   VLMTAFLYAYIHKTGDRELALLNERFIFVCNGDDNKFAISPQFDEEFGHDFSPELVELG
FT                   LTYEFDDITSDICENPYMSLTMVKTPFGVGFSLPVERIIAIMQWSKKGGVLHSYLAGIS
FT                   AIYESFNTPKLFKSIYAYLLWLTEEHEAEILAAMTQSSTALPIPSMLDVYRLHYGDDEI
FT                   WLQAADPLTDAQKEDARIAAADGARFELADADRRRKVEADRVEAARVKKAADAALKPVN
FT                   LTATRTPTEDDGKLKTPSGARIPSSAADGNWSVPATKQVNAGLTLKIPLNKLKSVPKSV
FT                   MEHNNSVALESELKAWTDAVRTSLGITTDEAWIDALIPFIGWCCNNGTSDKHAENQVMQ
FT                   IDSGKGAVTEMSLSPFIVHARMNGGLRRIMRNYSDETVLLITNNKLVAHWSMKHGASAN
FT                   AKYAFDFFVPRSWMNPQDIEVSKQARLAALGTGTYNTMLTSDTTNLRKTTNHRVLDSDG
FT                   HPELT"
FT   mat_peptide     6511. .7401
FT                   /product="capsid protein"
FT   polyA_signal    7462. .7466
XX
SQ   Sequence 7632 BP; 2160 A; 1795 C; 1700 G; 1977 T; 0 other;

d01091 Length: 7632  07-DEC-2007  Type: N  Check: 1313  ..
       1  aaaataaaac aaaacaaaac cgaacaaagc aaaacgaaac aaacacaaac
      51  atcacgcgct tcccaagctc acaatacttg tagagtgatt tctgtcatcc
     101  tactcttcgt gagcttttcc gcaaatcaac ccgtttgctt ttgcgccccc
     151  ttcaccttca ctctcgctcc tatggagcaa accctagctc aagctgtgtc
     201  acggaaaagc aaaacagaca cacctatggc agaagagcgg aaacatttca
     251  gccccatgaa tttttccgca aactttgttg ctcctgagct cttttatagt
     301  gccaatgtga ggaaaatcaa aaatatcttc agagagcgca gcacaactcg
     351  gtttctggac gcgatttcaa gtgactttga gcttgtcgct tttctcacct
     401  tgagtcctgc tcatttaatg caacttgaaa cagttctgcg ccacgagatg
     451  cgttcgtgcg ttgtgccaat tgtcacctct gatgccagct ttgaaacagt
     501  tgctgtcatc aaaaccgctc tggatggcat gagattccac tttggataca
     551  ctactcttga aaaggggtgg atttccatga tgcgccatgc ggagagttgc
     601  ctgcaagaga gctcttcttc ggctgtgaat gatctgcaga cgcaaattaa
     651  acgtgttgga tcgctgctcc tgagtggaaa aaatcgcgta gaaggctgcg
     701  aactatctgt cttgaacctc accgcgcgac gtttcaggat cgaatatggg
     751  ctaaacggta catactttgg cgaacatgtt gctatgctac gcggcttaaa
     801  acgttatatc tatggtaccg taccaaaaga gtttttgtgg gcgaaaacca
     851  aaaagcactc actgttcaca atccccgcgt ggatcaagcg tacgcccatc
     901  gattgtttct tgttctgtct tcgcgttatc cctatcttac ataggtgtgg
     951  tgttgccgtg tcacttattt actggtcgtg tgctgctgct ttaaattttc
    1001  ctgcttttat gtctttctta tttaagcgtc agttcgctaa gtatttagct
    1051  cactcctttg ctaaacactc catctacttt atgtttttaa ctatagttgc
    1101  tattttatgg tcttttcgca cttttacttc tcaaaaacca aaaatagtgc
    1151  ttcaagctag aagcacagca gaaaaagaga agaagcttat gatgattcta
    1201  gctagcgtcg ttgggatcac ttacctcttc gactacgaca tagcagaagc
    1251  tcttgggaat tgtctacata aaataagccg tctgtcctca tatctcctcg
    1301  acgaccatca aggcattgca tcacgaatgt ttggagcaag ctacgggctt
    1351  caagctggcg acagtgctga ggatgcagtc acaacgataa tcagcgactt
    1401  actgtctgtt acttttaaaa ttgtggatga agacgcatca caaggcaccg
    1451  tggaggacgc atcagagaca accttccaca gttgggttgg tgttaacaca
    1501  cttgcaggtc gcaatatgtc aagaccactc cagtatagcg tcaatgaaac
    1551  gtatgcactc acacctcaaa atgtccagct ccaagcgcga aaaatggcag
    1601  acgctaacaa ctgctggtca atggttgttg gtcatacggg atctggaaag
    1651  tccacatact tacctgtgca gtactccaac tacttatcca ctaagagtga
    1701  taggcgacag caaatcctta tctgcgagcc aactcaggct gccactgaga
    1751  atgtttgcgc tggcgtcgct gccaatctcg gcagagctgt ttatgggcgc
    1801  catgagggtt ggtccagaat gggggatcat tgcattcaag ttatgacgta
    1851  tggttctgcg ctccagtgtc atgccatgga ccctagcttc atatcaactt
    1901  tcgacgcaat tttccttgat gaagcacacg acgttaaaga acactctcta
    1951  gtctttgaga gcatttgtga cacattcaaa tccgttcgaa agttctatgt
    2001  ttcagcaact cccagagatg gtagtgtttg tcctgaagca gccaggaaat
    2051  atcctttaca tgttgaaact agcgtttgcg attcgtatcg aaagttcatt
    2101  gcagctcaag gcgggggaga tttgttggac atctcaaaac atgacacagc
    2151  tttagttttt ctagcgggac ggcccgagtg tattaaagct gctaatgcct
    2201  ggaatgctag tgtcaccggt gagaagcgcg ccttttcctt gtcgagcgac
    2251  aactttgcta ccgacttctc aatgctaact gagaggctca aaacacacaa
    2301  aaccatcatc ttcaccacga acataattga gacaggtgtt actctcagcg
    2351  ttgactgtgt tgtggatttc ggccatacaa tgcgcccatg tttagatctt
    2401  aatcaaaaag cattgcgtct tgatcgacgc agagtgacgc gaaacgaaag
    2451  acagcagaga attgggcgag cgggtcggct caaagacgga tacgccatag
    2501  tgtgtggaga tgttgataga gctgtaaacg tcatctctcc tgatgttctt
    2551  tatggtgccg ctctcctgag ttttaaacac aatgtgcctt tctacatgaa
    2601  cgaaacattt gagagttcct ggttggaggg tattacaaag gcacaagcag
    2651  atacaatgac aatcttcaag cttcctatat ttctaacacg agatctcatc
    2701  aatgcagatg gctcagttgc taaggagttt ctcgatgtcc taaagaagca
    2751  tcaattcaca acaagcgaca taaagcaagc accaagtgtc acagccaaac
    2801  acatcttccc aacttgggct tcatacttct ctctccacca agcacttcat
    2851  tatggtgatg ataaggatga ggtaccacac gaattgcgat atgcgcgcgt
    2901  tcccttctcc gtcacaactt tgagcaaatt cgattggcca gccttagctc
    2951  ttgcatgtga gaaacataga gcttccatgt caaatgtgtt tgctggcatc
    3001  gaagaacctg cacgcgttgt cactctacaa acaaatcctg cgaacataca
    3051  agcgagcatc acacatttaa cgcacatgag taagaactac aaaactctta
    3101  ttgaaaataa tcagcacgtg cgccaatcca tggtgacgaa tgttatgtat
    3151  aagtggttct cttctactcg catcacaaaa gatcttgata gaaacttgcg
    3201  aagatgcacg gataaccttg cagttgtcga ggccacactc agctcactta
    3251  gacaaatctt agctggcaac acgcaggttc atgcaacgcc acacatgcag
    3301  agcactcttg aggatattat tgggcttcaa gctagcgaca cacttacgga
    3351  agagagctta gcaagcgcac ttggcatctt tgttccgaag agcaacctct
    3401  ttctgctgct agctaccaaa ggttttaaac ttgtgtacgt tgtctgcatc
    3451  ttacttcttg tgaaccttgt ttatcttggt cttcgcaagt ggcgcgagca
    3501  tcttaagcag aaaggaagca atgaaatcct aactaacaca atgccagtta
    3551  gcgaaggggg ggaaattctc gctgaggtca tgaaaatgga gcctaaaatg
    3601  agaaagaaca tcaagaagga tatggatgca gccgttgaga gcaaattatg
    3651  tggtttcacc tttgtttttc cagatgatga taaaattggt cttgaaggta
    3701  agggaaacaa gtaccgccct cgcgaagacg ctcgtctcat gtactccacg
    3751  agggaagacg ccacccttga cgcttggaat gagaaagcaa aggaaaggcg
    3801  taagaaggtg accgacaaat ctgagccaga gcttcggaga gcctatgaaa
    3851  agagaccata cttcaatttc tacgaccttc aaacagatag caacattctg
    3901  gaagctattt tctacaccac tgaaggcgat gagtttttcc gaacagcaga
    3951  tcccaacaag gacatgaact tggttgctga caaactacgc tcttttctcg
    4001  acacaaagct tgttgttgga caccaccagc ggcagatgct agaagaaaca
    4051  gccaaggttg tcatcaaaga tacgaaggga actgcgcacc acatggacat
    4101  ttcacagcat gatccagacc atctaaagca gaatgggtcc ggcaaaattg
    4151  gatatccaga acaccggggg cagtttcgac aggaaggacc tgccaaaaca
    4201  gcggattacg atcttggagt tgagtttggc accgacaccg atgacatcac
    4251  gctcgaagcc tctactggga tattattgtc acaagttggg gtcgacgtcg
    4301  caacccgagt tggaagaatt ttcattggta ctttcaacat gaactgttac
    4351  ttctacagcg actggattct ggttccagga cacctgcaag acagatccgg
    4401  taacgtgaca attcaatttc ctgaccaaac agtgcaaacc acaactgatg
    4451  cactcaacgc aaatggtgtg aaacgattct atggattaga tgtgatagca
    4501  attcggcgcc ctgctatctt gagacctcgc accaagttgg tcaaagcttt
    4551  tgctattgag gaaccagtta tcgcacaaat ggtctttgtt gacgcacaag
    4601  gagttcgtaa gtttactcaa tctgttaggg ccagaaagga ggagaattcc
    4651  ggacgttggt cacataagat ttccactgtt cttggtatgt gtggatgcca
    4701  gttctggacg ttggaaagac agattgatgg aatccatgtt gccacaaact
    4751  acacaaagaa gcgcaacgag ttccaaccct tcactcagga ggtcgttgat
    4801  ttcataaatg gacctggaac aaaaatcccc tactgcccat gggtattcga
    4851  tagaccggct tgtgggtatg catcccacac agctttgttc gagaaaccaa
    4901  ccacactaac tgacatcatt cacatgcaag cttctgatgg tttgcacaac
    4951  atcaacaatg ccattgaggg tttcgggagt tcactgaggg gtcagctcgt
    5001  gtcaccacct actgaatcca ccaggcaacg tttcgataag ctgtttggca
    5051  gtggcagctt tgaactcatt gggcaaatga acaaaggctt aatcgacaaa
    5101  cacgtaattg ttggggaaaa tgatgatgtt catgacttca tgcgcgagca
    5151  cccaacattt acttggttga aagatttcat gaatgagtat gcgcctagtg
    5201  ttttgtctta ctctgcttac tacaaagacc tttgcaagta taatcgtgca
    5251  aaacatgtgc taacttacaa cccggaagag ctccattatg caacgaaagg
    5301  actgatcaag atgttggaag acgctggctt gacacaaggc agtgtgagga
    5351  caccccaaca agtcatttca gacattcaat ggaacacttc cgctggacct
    5401  agctatcaag ggaagaaacg cgacctctgt gcccatttga gtgatgatga
    5451  ggtgctgcat cttgctgagg tgtgtcgcca acaatttctc gaaggcaagt
    5501  caactggagt gtggaatggt tctttgaaag ctgagttgag aaccattgag
    5551  aaagttgagg cggagaaaac gcgtgttttc acagcctctc ccataacaag
    5601  cttgtttgcc atgaaattct acgttgacga ttttaacaag aagttctacg
    5651  ccaccaatct gaaagccccc catactgttg gcatcaataa gttcggtagg
    5701  ggatgggaaa aattgcatga taagcttaat cgccctggat ggttgcatgg
    5751  tagtggagat ggttctaggt tcgatagctc catcgatcct ctcttcttcg
    5801  acgttgtgaa aactattcgc aagcactttc tcccttctga gcatcataag
    5851  gccattgatc tcatatacga tgagattctc aacacaacca tctgcctggc
    5901  taatgggatg gtcatcaaga agaatgttgg gacacagcgg cagcctagca
    5951  ctgttgtcga taacacactt gtgctcatga ctgcatttct ctacgcatac
    6001  atccacaaaa caggagaccg tgaattggcc ttgctaaacg agcgtttcat
    6051  ctttgtttgc aatggcgatg acaacaagtt tgccatatct ccgcagtttg
    6101  acgaagagtt tgggcatgat ttctccccag aacttgttga acttgggctc
    6151  acgtacgaat ttgatgacat cactagcgac atttgcgaga atccttatat
    6201  gtccctcacc atggtgaaaa ccccttttgg cgttggtttt tctcttcccg
    6251  tggaaagaat catagctatc atgcaatggt ccaagaaagg gggagttctg
    6301  cactcatatt tggctggcat ttccgcaatt tacgaatcct tcaacacacc
    6351  aaaacttttc aaatcaatct atgcgtatct tctttggctc actgaggagc
    6401  acgaggcaga aattctcgca gccatgactc aatcctcaac tgctcttccc
    6451  ataccatcaa tgctcgatgt ttatcggttg cattatggtg atgatgaaat
    6501  ttggctgcaa gctgctgatc ctctcactga tgcacaaaaa gaagatgcac
    6551  gcattgctgc agctgatgga gcacgcttcg aactagccga tgctgatcgt
    6601  agacgtaaag ttgaggctga ccgtgtggaa gcggcaagag tcaaaaaggc
    6651  agctgatgct gcactaaaac cagttaacct cacagcaaca cgcacgccca
    6701  cagaagatga tggcaaactt aaaacaccat ctggcgctag aataccatca
    6751  tcagctgcag atggtaactg gagcgtgcca gcaacgaagc aagttaacgc
    6801  tggtttgaca ctcaaaattc ccctgaataa gctcaaaagt gtacctaagt
    6851  ctgttatgga gcataacaac tcagtcgcac tcgaatctga gctaaaagcc
    6901  tggactgatg ctgtgcgcac aagtttgggt atcacaactg atgaggcatg
    6951  gatcgatgcc ctcattccct tcatcggatg gtgctgcaac aatggcacct
    7001  cagacaagca tgctgagaat caagtaatgc aaattgacag cggaaaggga
    7051  gctgttacag agatgagtct gtccccattt attgttcatg ctcgaatgaa
    7101  tggtggactc cgaaggatca tgcgcaacta cagtgatgaa accgtcttac
    7151  tcatcacaaa caacaaacta gttgcacatt ggtcaatgaa gcatggcgct
    7201  tctgcaaacg caaaatacgc tttcgatttc ttcgtcccac gatcatggat
    7251  gaacccacag gatatcgaag tgtcaaagca agcgcgctta gcagcacttg
    7301  gaactggaac gtataacacc atgttaactt ccgacactac caatctgcgt
    7351  aagacaacca accacagggt tctggactca gatggacacc cagaactaac
    7401  ctaaaccatc accccgtgcc ttatacatca cccaccccca ctcataattc
    7451  agtctttaaa ttatgttcgt gacgtctttg tatcaggctc ggaacggttc
    7501  tatgatccat atgcctttgg cagttacaat gtcagcattc tcattgagga
    7551  gtatgacagc gtttgatcag ccgttttcaa tcatccgtcg ttggatggtg
    7601  gtgcacttac gatacgagta ccagaaggta at