ID   D01092; SV 1; linear; genomic RNA; STD; VRL; 3585 BP.
XX
AC   D01092;
XX
DT   05-AUG-1992 (Rel. 33, Created)
DT   07-DEC-2007 (Rel. 94, Last updated, Version 5)
XX
DE   Barley yellow mosaic virus RNA 2 for polyprotein, complete cds.
XX
KW   polyprotein; RNA 2.
XX
OS   Barley yellow mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Bymovirus.
XX
RN   [1]
RP   1-3585
RX   PUBMED; 2016599.
RA   Kashiwazaki S., Minobe Y., Hibino H.;
RT   "Nucleotide sequence of barley yellow mosaic virus RNA 2";
RL   J. Gen. Virol. 72:995-999(1991).
XX
CC   Data kindly submitted in computer readable form by:
CC   Satoshi Kashiwazaki
CC   National Agriculture Research Center
CC   Tsukuba, Ibaraki 305
CC   Japan
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3585
FT                   /organism="Barley yellow mosaic virus"
FT                   /segment="2"
FT                   /strain="II-1"
FT                   /mol_type="genomic RNA"
FT                   /clone="pBYT8, pBYT296"
FT                   /db_xref="taxon:12465"
FT   CDS             155. .2827
FT                   /codon_start=1
FT                   /product="polyprotein"
FT                   /db_xref="GOA:Q01207"
FT                   /db_xref="InterPro:IPR001337"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01207"
FT                   /protein_id="BAA00876.1"
FT                   /translation="MSASSSRQLFDCGSLDWPNKSLFGDPTTRDVMHEHISSTWNAVIR
FT                   RHMLAPNADAETILGRDGLPSAQFDAYGAMLPSFIQALNAPTTRLRITHRCPTAESILC
FT                   ADASHAPWLYMANNVCAYEATHLKPVQTFIAFDFAHGYCYLSLFIPLSFRITFENARSF
FT                   SRFLEQLPDILGAYPTLAAIYKTMLFAIRLFPEVLQAPIPIIAKRPGVLQFHVSDARGL
FT                   PPSWFPMKCGSVRSFVALITNNLNSDLLDGIVGSNGDGEHYTNWNSGHDHWIVNRFITV
FT                   RDLHSSLKSALDVDLDTEGGRNAVLDLLLDLGVTNLVRREKRFPAHFQGAESVYLLLSC
FT                   ERVGNELVAVQDALQEPLANHSGLDLRALIINLGGLPSRHSDICYTRNIFENDNHLVWN
FT                   FEFYRIASITRNAQIDRDMLSSSMANLFSNFVSESSNGQYRVKEPRPIAQYRVEHDEPV
FT                   ASGAPSAWWQVLIGITTAILGAIIFFLWRCFLRAKRVKFQAKDSFPWFTTSGDDDSPPP
FT                   PGDSPSHPPGRSPDRVLPRTVVRDLSFNDDDDLHSVDLDEAGSRFGEVVSLIARGNLRE
FT                   LAGAIPESLSNLTLLQTSASGSGFYTMVALYLATLGDAITAFHEHNDASPTTTQSLRTV
FT                   ELQLEARGLRFNEAGTPANLIQRGVNSSVGRALVRLTQSALLATGEKFRTRMATTLERI
FT                   AAERLNTLTAYDQRVIEMTTELLAAIKTALEVERSELTPHLANAEALLQVYNNLFSTDY
FT                   ASASLLALRREMILRSAEGRVGEQPTSASDAANEELVQRSMTKLDKEIELFQAQIDSQR
FT                   RAVTITEASNLRENILQPINTVANIAMAGAFLRGGARHRMPGMPDVAAPMPNPFRAFSG
FT                   RGHSLTTTRSGGLFRRPRV"
FT   polyA_signal    3471. .3475
XX
SQ   Sequence 3585 BP; 925 A; 930 C; 779 G; 951 T; 0 other;

d01092 Length: 3585  07-DEC-2007  Type: N  Check: 2303  ..
       1  aaaataaaac aaaacaaaac cgaacaaagc aaaacgaaac aaacacaaac
      51  aacacacgct ccccgagctc acaatactcg tagagtgatt tccgtcatcc
     101  tactgtttgc aagctttcca gcaaaccaac ccgcttgctt tcaaaccctc
     151  catcatgtct gcttctagtt cacggcaact cttcgactgc ggcagtcttg
     201  actggccaaa taagagctta tttggcgatc ccacaacgcg agatgtcatg
     251  cacgaacaca tttccagcac gtggaatgcg gttattagaa ggcacatgtt
     301  ggcgcccaat gccgacgccg agactatatt gggccgtgat ggtttaccat
     351  ctgctcaatt tgacgcttat ggagctatgc tacctagctt cattcaagct
     401  ctaaatgcac ccacaacgcg tctccgaatc acgcaccgct gtcccaccgc
     451  tgagtccatc ttgtgcgctg atgcatccca tgctccttgg ttgtacatgg
     501  caaacaatgt atgcgcatac gaagcaactc acctgaagcc tgtacaaact
     551  ttcatcgctt tcgactttgc gcatggctat tgttacctca gtctcttcat
     601  accactcagc tttcgcatca ccttcgaaaa tgctcgaagt ttcagtcggt
     651  tcctcgagca gctccctgac atcttaggtg cgtatccaac attggccgca
     701  atatataaaa caatgctatt cgctattagg cttttcccag aggtgctaca
     751  agctccaatt cccatcatcg caaaaaggcc tggcgtgctc caattccacg
     801  ttagtgatgc cagaggacta ccaccctcat ggttccccat gaagtgtggc
     851  agcgtacgat ctttcgtagc actcattacc aacaacctaa acagcgattt
     901  gcttgatgga attgttggtt caaatggtga tggcgagcac tacacaaatt
     951  ggaactctgg acatgatcac tggattgtga atcgattcat aacagtcaga
    1001  gatttgcaca gtagcttaaa gtcagctctg gatgttgact tggacacaga
    1051  gggtggacga aatgccgttc tcgatttgct tctagatctt ggggtcacta
    1101  atcttgttcg aagagagaaa cgcttcccag cacacttcca aggagctgaa
    1151  agcgtatatc tacttctatc gtgcgagaga gttgggaacg agttagtagc
    1201  cgtgcaagat gctctgcagg aaccattggc taatcattct ggtttggatt
    1251  tgagagctct catcatcaat cttggcggtt taccaagcag acactctgat
    1301  atttgctaca cacgcaacat ttttgaaaac gataatcatc tggtttggaa
    1351  ctttgagttc taccggatag cctcaatcac gaggaatgca caaattgaca
    1401  gagatatgct gagctcatcc atggcgaact tgtttagcaa ctttgtctca
    1451  gaatcgtcaa atggccagta cagagtcaaa gaaccaagac ctattgctca
    1501  gtacagggtt gagcatgacg aaccagttgc tagtggtgcc ccatctgctt
    1551  ggtggcaggt tcttattggc atcaccaccg caatccttgg cgcaataata
    1601  ttctttctct ggaggtgttt cttacgtgct aagcgtgtga aattccaggc
    1651  gaaggactcc ttcccatggt ttaccacatc tggtgatgat gactcaccgc
    1701  ctccccctgg tgactccccg tcgcaccctc ctggacgcag cccagatcga
    1751  gttcttccgc gcacagttgt tcgagatctt agcttcaatg acgatgatga
    1801  cttacacagc gttgatctcg acgaagctgg atcgcgtttt ggggaggttg
    1851  tctctttaat tgcaagggga aatcttcgcg agttagctgg tgcaattcct
    1901  gaatctctca gcaacctaac cctccttcaa acgagtgcga gtgggtcagg
    1951  tttttacact atggtggctt tgtaccttgc cactttaggg gatgccatca
    2001  ctgcgtttca tgagcacaat gatgcctcac ctaccacaac tcaatcactg
    2051  cgaaccgtcg aacttcagct tgaagctcgt ggcttacgtt tcaatgaagc
    2101  tggtacaccc gcaaatctca tccagagggg cgttaattct tctgttggta
    2151  gagcacttgt gcgactcaca cagagtgctc tcctagctac tggtgagaag
    2201  ttccggacac gcatggcaac cacacttgaa agaattgctg ctgagcgtct
    2251  taacacatta accgcttacg atcagcgagt tattgaaatg acaactgagc
    2301  tgctagcagc gatcaaaacc gctcttgagg ttgagcgcag tgaacttacc
    2351  ccacatcttg caaatgccga ggctttgctt caagtttaca ataatctctt
    2401  cagcaccgat tacgcttcag catcgctgct tgctctcagg cgcgagatga
    2451  ttcttaggag tgccgaaggg cgtgttggag aacagcccac tagtgcttct
    2501  gacgctgcta acgaggagtt ggttcaacgt tctatgacaa aattggataa
    2551  ggaaattgag ttgttccaag cacaaattga tagccagcgc cgcgccgtta
    2601  ccataactga agcatccaat ctcagagaga atatattgca gccaatcaac
    2651  actgttgcaa atattgctat ggctggagct tttctgcgtg ggggcgcacg
    2701  tcatcgcatg ccaggaatgc cagacgtagc tgcgcccatg cccaaccctt
    2751  ttcgagcttt ctcagggagg ggacattcac tcacgacaac tcgaagtggc
    2801  ggtcttttcc ggcgccctcg agtctagaat tctcatcaca gcagcattta
    2851  ctttccaccg ccttagcata gtttagatca atatcatcca tttctctatc
    2901  ctctcgccat ctgcacacca ttgccattaa tatggtagag ttagcgattc
    2951  atcccttgct acgctcaaaa tctccatctt tagaccacct gcaaacacac
    3001  aaaataccaa aaataccatt tatcattctg tttcaaacgc cagcatttta
    3051  aattacccgc aattgcatta tcgtttcgcc atcaaagtat ggttcgtttc
    3101  atcaacatct gctcgcacga ttgggtgtat ggggccagtg ttgtttcggg
    3151  tatggaattc aaatggtaag aaattgattc ttctcaccat gagttttcca
    3201  ggggataagt tcggtgctac agctagcggc tgtatcctta gcgatgcccc
    3251  acaccacgaa acaccattga ttcttaggaa ttagcctttc aaatatccca
    3301  actgcaatga gcacgatagc attgcatctc cactcaaggt ccggttagag
    3351  tccctggcag gtgtgggcta caggagcatg ggaatgcttc tctgtcacca
    3401  tctgtcgtct gcggcctcta tctagcacta cgagtggagc cacgtcttta
    3451  aatccccagc atgtttactt tatgttctgc atagaaaacg tcacatctgt
    3501  gatacaaaaa catgcaacac gtgcccatca tcggtcgcgg gttgtaggtc
    3551  tgacgaacaa caactttgta cacaggaaat gtgac