ID   D01099; SV 1; linear; genomic RNA; STD; VRL; 3585 BP.
XX
AC   D01099;
XX
DT   25-AUG-1992 (Rel. 33, Created)
DT   07-DEC-2007 (Rel. 94, Last updated, Version 9)
XX
DE   Barley yellow mosaic virus RNA 2 for polyprotein, complete cds.
XX
KW   polyprotein; proteinase; RNA 2.
XX
OS   Barley yellow mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Bymovirus.
XX
RN   [1]
RP   1-3585
RX   PUBMED; 2016598.
RA   Davidson A.D., Proels M., Schell J., Steinbiss H.H.;
RT   "The nucleotide sequence of RNA 2 of barley yellow mosaic virus";
RL   J. Gen. Virol. 72:989-993(1991).
XX
CC   Data kindly submitted in computer readable form by:
CC   Andrew D. Davidson
CC   Max-Planck-Institut
CC   f. Zuechtungsforschung
CC   Carl-von-Linne-Weg 10
CC   D-5000 Koeln 30
CC   FRG
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3585
FT                   /organism="Barley yellow mosaic virus"
FT                   /segment="2"
FT                   /isolate="German"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:12465"
FT   CDS             156. .2828
FT                   /codon_start=1
FT                   /product="polyprotein"
FT                   /db_xref="GOA:Q01365"
FT                   /db_xref="InterPro:IPR001337"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01365"
FT                   /protein_id="BAA00884.1"
FT                   /translation="MSTSSSRLFFDCGSLDWPNKSLFGDPTTRDVMDEHISSTWNAVIR
FT                   RHMLAPNADAETILGRDGLPSAQFDAYGAMLPSFIQALNAPTTRLRISAPLSTAESILC
FT                   ADASHAPWLYMANSVCAYEATHLQPVQTFIAFNFAHGYCYLSLFIPLSFRITPENARSF
FT                   SRFLEQLPDILGAYPTLASLYKTMLFAVRLFPEVLQAPIPIIAKRPGVLQFHVSDARGL
FT                   PPSWFPMKCGSVASFIALITNNLNSDLLNGIVGSNGDGEHYTNWNSGHNHWIVNRFITV
FT                   KDLHSSLKSALEVDLDTEGGRNAVLDLLLDLGVTNLVRREKRFPAYFQGAESVYLLLSC
FT                   ERVGNELVAVQDALQEPLANYTGKDLRALIINLGGLPSRHPEICYTRNIFENDNHLVWN
FT                   FEFYRIASITKNAQIDRDVLSSSMANLFSDFVSESSNGEYRVKEPRPVTQYRVEHDEPV
FT                   ASGAPSAWWQVLVGITTAILGAIIFFLWRCFLRAKRVKFQAKDSFPWFTTSGDDDLPPP
FT                   PGDSPSRPPGRSPDRVLPRTVVRDLSFNDDDDLHSVDLNEAGSRFGEVVSLIARGNLRE
FT                   LAGAIPESLSNLTLLQTSASGSGFYTMVALYLATLGDAITAFHEHNDASPATIQSLRTL
FT                   ELQLEARGLRFNEAGTPANLIQRGVKSSVGRALVRLTQSALLATGENFRTRMAATLERI
FT                   AAERLNTLTAYDQRVIEMTTELLAAIKTALEVERSELTPHLANAEALLQVYNNLFSTDY
FT                   ASASLLALRREMILRSAEGRVGEQPTSASDAANEELVQRSMTKLDKEIELFQAQIDSQR
FT                   RAVTITEASNLRENILQPINTVANIAMAGAFLRGGARHRMPGIPDVAAPMSNPFRAFSG
FT                   RGHSLTTTRGAGLFRRPRV"
FT   mat_peptide     156. .920
FT                   /product="proteinase"
XX
SQ   Sequence 3585 BP; 913 A; 897 C; 780 G; 995 T; 0 other;

d01099 Length: 3585  07-DEC-2007  Type: N  Check: 5740  ..
       1  aaaaataaaa caaccctaaa ccaaaacaaa caaaacgaaa caaacacaaa
      51  catcgcacgc tcctcaggct cacaacactt gtagagtgat ttctgtcatc
     101  ctactgtttg taagctctcc agcaaatcaa ctcgctcgct ctcaaattct
     151  ccaccatgtc tacttccagc tcacggttat tctttgactg tggcagtctt
     201  gattggccaa ataaaagctt atttggcgac cccacaacac gagatgtgat
     251  ggacgaacac atttctagca cgtggaatgc ggttattagg aggcacatgt
     301  tggctcccaa cgccgacgcc gaaaccatat tgggccgtga tggtttacca
     351  tctgctcaat ttgacgcgta tggagccatg ctacctagct ttatccaagc
     401  tctaaacgca ccaacaacgc gtcttcgaat cagcgcaccg ctgtctaccg
     451  ccgagtccat tttgtgcgct gatgcatctc acgctccttg gttgtacatg
     501  gcaaacagtg tgtgcgcata cgaggcaact catttgcagc ctgtacaaac
     551  tttcatcgcc tttaacttcg cacatggtta ttgctacctc agtcttttca
     601  taccactaag ctttcgcatt acccccgaga atgctcgaag tttcagtcgg
     651  ttccttgagc agcttcccga cattttaggt gcgtatccaa cattggcctc
     701  actatataaa acaatgttat ttgctgttag gcttttccca gaggtgctac
     751  aagctccaat ccccattatt gcaaaaaggc ctggtgtgct acaattccat
     801  gttagtgatg ccagaggact gccaccttcg tggttcccca tgaagtgcgg
     851  cagtgtagca tctttcatag cgcttattac caacaacctt aacagcgatt
     901  tgcttaatgg gattgttggt tcaaacggtg atggtgagca ctacacaaat
     951  tggaactctg ggcataatca ctggattgtg aatcgattta taacagtcaa
    1001  ggatttacat agcagtttaa aatcagctct agaagttgat ttggacacag
    1051  aaggtgggcg aaacgctgtt ctcgatttgc ttctagatct tggagtcact
    1101  aatcttgttc gaagagagaa acgtttccca gcatatttcc agggagctga
    1151  aagcgtatac ctgcttcttt catgtgaaag agttgggaac gagctggtgg
    1201  ctgtgcaaga tgctcttcag gaaccattag ctaattatac tggaaaggat
    1251  ttgagagctc tcatcatcaa tcttggcggt ttaccaagca gacaccctga
    1301  gatttgttac acacgtaaca tctttgaaaa tgataatcac ctggtttgga
    1351  attttgagtt ctaccgaata gcctcaatta cgaagaatgc acaaattgat
    1401  agagatgtcc ttagctcatc catggcgaac ttatttagtg attttgtttc
    1451  agagtcatca aatggtgagt acagagttaa ggaaccaaga cctgttactc
    1501  agtacagggt tgagcatgat gaaccagttg ctagtggtgc cccatctgct
    1551  tggtggcaag ttcttgttgg catcaccacc gccattctgg gcgcaataat
    1601  attctttctt tggaggtgtt tcttgcgtgc taagcgtgtc aaattccagg
    1651  caaaggattc cttcccatgg tttaccacgt ctggtgatga tgacctcccg
    1701  cccccccctg gtgattcccc gtcacgccct cctgggcgca gcccggatcg
    1751  agttcttcca cgtacagttg ttcgagatct cagcttcaat gatgatgatg
    1801  atttacacag tgttgatctt aatgaagctg ggtcgcgttt tggggaggtt
    1851  gtctctttaa ttgcaagggg aaatctccgc gagctagctg gtgcgattcc
    1901  tgaatctctt agcaacttaa ctctccttca aacgagtgca agtggatctg
    1951  gcttttacac tatggtggct ctgtaccttg ccactttagg ggatgctatc
    2001  actgcattcc atgagcataa tgatgcttca cctgccacaa ttcaatcact
    2051  gcgcacgctc gagcttcagc ttgaagcccg tggtttgcgt ttcaatgaag
    2101  ctggcacacc cgcaaatctc attcagaggg gcgttaaatc ttctgttggt
    2151  agagcacttg tgcgactaac acagagtgct cttctggcca ctggtgagaa
    2201  ctttcggaca cgcatggcag ccacacttga aagaattgct gctgagcgcc
    2251  tcaacacgtt aaccgcctat gatcagcgag tcatcgagat gacaactgaa
    2301  ctcctagcag caatcaagac tgctcttgaa gtcgagcgca gtgaactcac
    2351  tccacatctc gcaaacgccg aggctctgct tcaagtttac aacaatctct
    2401  ttagcaccga ttatgcttca gcatcgctgc ttgctcttag acgcgagatg
    2451  attcttagga gtgctgaagg gcgtgttgga gaacagccaa ctagtgcttc
    2501  tgatgcggct aatgaggaat tagtccaacg ttccatgaca aagttggata
    2551  aggaaattga gttattccaa gcacaaattg atagccagcg tcgcgctgtc
    2601  accatcactg aagcatccaa tctcagagaa aacatattgc agccgatcaa
    2651  caccgttgcg aatattgcca tggctggagc ttttctgcgt gggggcgcgc
    2701  gccatcgcat gccagggata ccagatgtgg ctgcgcccat gtccaaccct
    2751  tttcgagctt tctcagggag gggacattca ctcacaacaa ctcgaggtgc
    2801  tggtcttttc cgacgccctc gagtttagtt tttccatcat agcactattt
    2851  actttccgcc gccctagcat aatttagatc aacattatcc atttcttcct
    2901  cctttcacca tctgcacacc gctgccatta atatggtaga gttagcggtt
    2951  catcccccgc tacgctcaac atctccatcc ttagatcacc tgcaaacaca
    3001  taaaatacca aaaataccat ttatcattct gtctcaagcg ccagcatttt
    3051  aaattacccg caattgcatt atcgttttgc catcaaagta tggttcgttt
    3101  catcaacatc tgctcgcatg attgggtgta tggggccagt gttgttttgg
    3151  gtatggaaat tgattggtga gaattgattc ttctcaccat gagttttcca
    3201  ggggataagc tcggtgctac agctagcggc tgtatccttc gcgatgcccc
    3251  acaccacaaa acaccactga ttcttaggaa ttagcctttc aaatatccca
    3301  actgcaatga gcacgatagc attgcatctt cactcaaggt ccggttagag
    3351  tccctggcag gtgtgggcta caggagcatg tgaatgctgc tctgtcacca
    3401  tctgtcgtct gcggtctcta tctagcacta cgagtgaagc cacgtcttta
    3451  aatccccagc atgtttactt tatgttctgc atagaaaacg tcacatctgt
    3501  gatacaaaaa catgcaatac gtgcccatca ttggtcgcgg gttgcagtct
    3551  gacgaacaac aacctttgta cacaggaaat gtgac