!!NA_SEQUENCE 1.0
ID   BMMKA1     standard; RNA; VRL; 3945 BP.
XX
AC   D10949;
XX
SV   D10949.1
XX
DT   05-NOV-1992 (Rel. 33, Created)
DT   07-JUL-2003 (Rel. 76, Last updated, Version 8)
XX
DE   Barley mild mosaic virus gene for polyprotein precursor, partial cds.
XX
KW   .
XX
OS   Barley mild mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Bymovirus.
XX
RN   [1]
RP   1-3945
RA   Kashiwazaki S.;
RT   ;
RL   Submitted (15-APR-1992) to the EMBL/GenBank/DDBJ databases.
RL   Satoshi Kashiwazaki, Scottish Crop Research Institute, Virology Department;
RL   Invergowrie, Dundee DD2 5DA, United Kingdom (E-mail:mail@scri.sari.ac.uk,
RL   Tel:44-382-562731(ex.2125), Fax:44-382-562426)
XX
RN   [2]
RX   MEDLINE; 93019037.
RX   PUBMED; 1402809.
RA   Kashiwazaki S., Nomura K., Kuroda H., Ito K., Hibino H.;
RT   "Sequence analysis of the 3'-terminal halves of RNA 1 of two strains of
RT   barley mild mosaic virus";
RL   J. Gen. Virol. 73:2173-2181(1992).
XX
DR   GOA; O39510.
DR   SPTREMBL; O39510; O39510.
XX
CC   Sequence updated (08-Jan-1996) by: Satoshi Kashiwazaki
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3945
FT                   /db_xref="taxon:12466"
FT                   /mol_type="genomic RNA"
FT                   /note="clones Ka1SK11 and Ka1SK46"
FT                   /organism="Barley mild mosaic virus"
FT                   /strain="Ka1"
FT   CDS             <1. .3608
FT                   /citation=[2]
FT                   /codon_start=3
FT                   /db_xref="GOA:O39510"
FT                   /db_xref="SPTREMBL:O39510"
FT                   /note="capsid protein, possible polymerase and proteinase"
FT                   /product="polyprotein precursor"
FT                   /protein_id="BAA01742.1"
FT                   /translation="MVAALLMYLVFWVSPRKQDDITIEGKGRAYNRDKRMGYDSYEEDE
FT                   VRNKINKKFKERSTRFSNNSKPETSSKYRNLKQEFVNFYNLKTDANVLQAVFTAMDGAV
FT                   LLQTENPMADIGHVNRLLQDHFEDSESQAVHEGLNTMVKCHLTMKDGRQFELDMEQHDP
FT                   ETVAKLGGEVGFRMNRDDLRQVGATRYINPRAQTSAATLEGMTMKPMSSFTIDSAKMVG
FT                   FIKTAKDTLNCILYGDWIIAPAHTQQGEGDITFIFQHVQFTTTTERLASYGIRQFKGLD
FT                   LVVIRRPQQIRAVKKDMRASILDTPTEIQMLYLSTKGGKYQVSTSAVCFPHYNNRWGHV
FT                   ISTAEGMCGCIVFNPTTNHIVGIHVSYNDTRRRNEFQAFTSDVLTTINAPGHEIPFSPW
FT                   IFDWKFCGYTTKPRNMQSAPSTLERLNINATGFGFKLDAQEIKPAMLRSTESFSREFPD
FT                   TQFKLIGEVKKGLIDKHTITGENPYFLEFLNTFKPYQWVQAFMDEYAPSILAYDAYFKD
FT                   LKKYDRPPHANVFCQDTLTKAKHKMISILEEAGMGRTLVRTTEQVLLDMAWTTSGGPLY
FT                   HGKKIDIVQHLSDDELVQFSEACQQALITGTLDGVWNGSLKAELRSSQKILERKTRVFT
FT                   AAPITSLIAMKYYVDDFNKQFYKTHLKAPHTVGINKFNRGWQNLYEKLNKPGWTHGSGD
FT                   GSRFDSSIDGFLFDVIKDIRKHFMDTEHHKELDTIYEEIVNTKICLANGLVIQKNCGNN
FT                   SGQPSTVVDNTLALMTAFLYAYARLTGDHAFELMDENFVFVCNGDDNKFSMSPSFMAKF
FT                   GCDFSPFLSELGLTYEFDEATEDICENPYMSLTMVRTSFGIGFSLSIERIVAILQWSRA
FT                   GGVLHAYLSGIAALFESFNTPKLFNLVHTYLLWLVTEHEEELFSMMELKDMFMPLPTRE
FT                   QIALLHYVGTEPIVEETFLQAGHEEPDPIVPPVPDTDLTNMAAAPPDNRKSRAVIPRGT
FT                   SDWSLPEPKMRTLGFKSKINIETLANVPDGYMNTFASVATESQRRKWEEAARGDFGITD
FT                   DEKWEKLLIAACIYFADNGTSPNFDEELTMEVNGGLNSIKEYPVRPFVVRAKKISTLRR
FT                   IFRCYSIETKLMFVKLRRVPHWAIKHGCLDEIVFDFMIPDQFTSRTALETLKQTKLAAI
FT                   GVGTSNSLLTSEQTNMRTTETRRRNDYDGHEALLR"
FT   3'UTR           3606. .3945
FT   polyA_signal    3860. .3864
XX
SQ   Sequence 3945 BP; 1110 A; 1060 C; 891 G; 884 T; 0 other;

  D10949  Length: 3945  July 15, 2003 09:15  Type: N  Check: 5521  ..
       1  ttatggttgc cgccttactc atgtatctcg ttttctgggt ttctcccagg
      51  aaacaggacg acatcaccat tgaggggaaa ggcagggcat acaaccgtga
     101  caagcgcatg gggtacgact cctacgagga agacgaagtt cgcaacaaga
     151  tcaacaaaaa gttcaaagag cgcagcacaa ggttctccaa taactccaag
     201  ccggaaacaa gctcgaaata ccgcaatctg aagcaagaat ttgttaactt
     251  ctataatctc aaaaccgatg cgaacgtgct acaagccgtg ttcactgcaa
     301  tggacggggc cgtccttctt caaaccgaaa atccaatggc agacattggc
     351  catgtcaata gactgctgca ggaccacttt gaagacagtg agagccaagc
     401  tgtgcatgag ggcctcaaca ccatggtcaa gtgccaccta actatgaaag
     451  atggaagaca gtttgagctc gacatggaac aacacgatcc cgaaactgtc
     501  gccaaacttg ggggcgaggt tggtttcaga atgaacagag acgacttacg
     551  tcaagttgga gccacacgat acatcaaccc aagagcacaa acatctgcag
     601  cgacgctcga aggcatgacc atgaaaccca tgagttcttt caccattgac
     651  agcgcaaaga tggttggctt catcaagacc gcaaaagaca cactcaactg
     701  catcctttac ggcgactgga ttatagctcc tgcgcacaca cagcagggcg
     751  agggggacat aacattcatc ttccagcacg tacaattcac gaccacaact
     801  gagcgtttag ctagctatgg cattcgacaa ttcaaaggtc ttgaccttgt
     851  tgtcatccgg cgccctcagc agatacgcgc agtcaagaag gacatgcgtg
     901  ctagcattct cgacacaccc actgaaatac aaatgctcta cttgtccact
     951  aaaggtggta agtaccaagt gtccacgtcc gctgtgtgct ttccacacta
    1001  caataaccga tggggacacg tcatttcaac agcagaaggc atgtgcggct
    1051  gtattgtatt caaccccacc acgaaccaca tcgttggaat ccacgtctcc
    1101  tacaacgaca cgcgcagaag aaatgagttt caagctttca caagtgacgt
    1151  tctgacaacg attaatgcac ccggacacga gatacctttc agcccatgga
    1201  tcttcgactg gaagttttgt gggtacacaa caaaaccacg aaacatgcaa
    1251  agcgcaccga gcacactcga gcgactcaac atcaatgcca caggatttgg
    1301  tttcaagctc gatgcacagg agattaagcc agccatgctt cgttccacag
    1351  agtcgttctc cagggagttt ccagacacac agtttaaact cattggggaa
    1401  gtgaagaaag gactcatcga caaacacaca atcacaggag agaacccata
    1451  cttccttgaa ttcctgaaca cattcaaacc ataccaatgg gtgcaggcct
    1501  tcatggacga gtacgcaccc tccatccttg cctatgacgc gtatttcaaa
    1551  gatctgaaga aatatgatag gccaccacac gcaaatgttt tctgtcagga
    1601  cacactaacc aaagctaaac ataagatgat cagcatcctc gaggaagcag
    1651  gcatgggaag gaccctagta cgaaccaccg agcaggtctt gcttgacatg
    1701  gcgtggacca cctccggtgg acccttgtac catggtaaga agatcgacat
    1751  tgtgcaacac ttgtctgacg acgagcttgt acagttcagt gaggcctgcc
    1801  aacaggctct tatcactgga acgctggatg gagtctggaa cggatcactc
    1851  aaagccgagc tgcgctcttc gcagaaaatc ctcgaacgga aaacccgcgt
    1901  ttttactgct gcacccataa caagcctcat tgcgatgaaa tactatgtgg
    1951  atgatttcaa caaacagttc tataaaaccc atctcaaagc accgcacaca
    2001  gtcggaatca acaagttcaa ccgcggatgg cagaatctgt atgagaagct
    2051  caacaaaccc ggatggacgc atgggagtgg ggacggttcc aggtttgaca
    2101  gttccattga tggattcctt ttcgatgtca tcaaggacat tcgaaagcat
    2151  ttcatggaca cggaacacca caaagaactc gacacaatct acgaagagat
    2201  agtcaacacg aagatatgtc tggcgaacgg cctggtcatt cagaagaatt
    2251  gcgggaacaa cagtgggcag ccaagcactg ttgtggacaa cacactcgca
    2301  ctcatgacag cttttctcta cgcatatgcc cggctcactg gagatcacgc
    2351  cttcgaactc atggacgaaa acttcgtctt cgtctgcaat ggtgatgaca
    2401  acaagttttc catgtcacct agcttcatgg cgaagtttgg atgcgatttc
    2451  tccccattcc tctctgagct cgggctaacc tacgaatttg atgaagcaac
    2501  tgaagatatc tgcgaaaacc cctacatgtc cttgacgatg gtccgcacct
    2551  cgtttgggat tggtttctct ctctccattg agcgcatcgt tgcaatcttg
    2601  cagtggagtc gcgccggtgg agtcctgcat gcctatctct ctggcattgc
    2651  cgctcttttc gaatctttca acacacccaa actcttcaat ctcgtgcaca
    2701  catatctcct ttggctcgtc acagagcacg aggaggaact cttctccatg
    2751  atggaactca aagacatgtt catgcccttg cccactaggg aacagatagc
    2801  cttgctgcac tacgttggaa ctgagcccat cgtggaggaa acatttctgc
    2851  aagcaggaca cgaagaacca gaccccatcg ttcccccagt tcctgacacc
    2901  gatctaacga acatggctgc cgcaccaccc gacaacagaa agtcgcgcgc
    2951  cgtcatcccc cgtgggacca gtgactggag cctgcctgaa cccaaaatgc
    3001  gaacactggg tttcaagtcc aagatcaaca tcgaaacact tgccaatgtc
    3051  cccgacgggt atatgaacac ctttgcatcc gttgcaactg aatcgcaacg
    3101  taggaaatgg gaggaggccg cacgtggcga tttcggcatc actgacgatg
    3151  agaaatggga gaagttgctc attgctgctt gtatatattt cgcagacaat
    3201  ggcacctcac cgaatttcga cgaggaactc actatggagg ttaatggcgg
    3251  tctcaactcc atcaaagagt accccgttcg cccctttgtc gttagagcca
    3301  aaaagatttc cacgctgcgc agaatctttc gctgttactc catcgaaacg
    3351  aagctcatgt tcgtgaagct gaggcgcgtg ccacactggg ccataaagca
    3401  cggatgcctc gatgagatcg tctttgattt catgatcccc gaccagttca
    3451  cctctaggac tgcgcttgaa acactgaagc agaccaaact ggctgccatt
    3501  ggtgttggca caagcaattc tctcctcacc tccgagcaga cgaacatgag
    3551  gaccactgaa acccgacggc gcaatgacta cgatggtcac gaggcgctcc
    3601  tccggtagat ctctcatgca cttgcatttc cttttaagca atgcatttca
    3651  atacgctttt aattatatca agcgtcaaga atttctcccg cttgcagtta
    3701  atccttatag ggtggcactt tgtgttatgc aatggaaaat tcagtgacgc
    3751  aatcaaccat cattggttgg tgacaacgca gtactttctt tatttcacat
    3801  caagcgacca gcacatcgcc cgcttacagc taatcctacc tgagggtggc
    3851  actctgtgtt atgtaatgga atgtgcaatc tcgcaaccaa ccgtcattgg
    3901  ttgatggtgc ggccaacacc cgcactcttg tataccggaa aggtt