!!NA_SEQUENCE 1.0
ID   BMD408     standard; genomic RNA; VRL; 7263 BP.
XX
AC   D83408;
XX
SV   D83408.1
XX
DT   22-MAR-1997 (Rel. 51, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Barley mild mosaic virus genomic RNA1 for polyprotein precursor, complete
DE   cds.
XX
KW   polyprotein precursor.
XX
OS   Barley mild mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Bymovirus.
XX
RN   [1]
RP   1-7263
RA   Kashiwazaki S.;
RT   ;
RL   Submitted (06-FEB-1996) to the EMBL/GenBank/DDBJ databases.
RL   Satoshi Kashiwazaki, National Agriculture Research Center, Department of
RL   Plant Protection; 3-1-1 Kannondai, Tsukuba, Ibaraki 305-8666, Japan
RL   (E-mail:skashiwa@narc.affrc.go.jp, Tel:81-298-38-8932, Fax:81-298-38-8929)
XX
RN   [2]
RP   1-7263
RA   Kashiwazaki S.;
RT   "The complete nucleotide sequence and genome organization of barley mild
RT   mosaic virus (Na1 strain)";
RL   Unpublished.
XX
RN   [3]
RP   1-7263
RX   MEDLINE; 97128984.
RX   PUBMED; 8973524.
RA   Kashiwazaki S.;
RT   "The complete nucleotide sequence and genome organization of barley mild
RT   mosaic virus (Na1 strain)";
RL   Arch. Virol. 141(11):2077-2089(1996).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .7263
FT                   /db_xref="taxon:12466"
FT                   /mol_type="genomic RNA"
FT                   /organism="Barley mild mosaic virus"
FT                   /clone="Na1SK2, Na1SK15, NH38"
FT                   /strain="Na1"
FT                   /segment="1"
FT   5'UTR           1. .148
FT   CDS             149. .6925
FT                   /codon_start=1
FT                   /db_xref="GOA:P90245"
FT                   /db_xref="HSSP:1HEI"
FT                   /db_xref="InterPro:IPR001205"
FT                   /db_xref="InterPro:IPR001410"
FT                   /db_xref="InterPro:IPR001592"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001730"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/Swiss-Prot:P90245"
FT                   /product="polyprotein precursor"
FT                   /protein_id="BAA18953.1"
FT                   /translation="MEEFIPEVFYQNQVQSLKKILKSWKRDTSIYAYLAREQEVLAFLV
FT                   LSPAHIAKLNKLLTEESARCALLAQNCETIEALAVVRQALQGVTLHFGDNGMEKGWLHM
FT                   MKALDACLDESFSENAAALKKSIQAVGHKLIAAKNRIESCERSVNHLTTFQFAREYGLS
FT                   TTYFEKLSNFGGHIRSFVWSSDSGEIFPKPKRSSRTKRISTFTSYYWGEFWCNCIWLLC
FT                   SLWSPARWCFNSVVFIWSLCGVLNLSMVVLQFTLKRHFGRYYFRYVMSGVLAICAVCCV
FT                   HLKNRKGPILQASQKDKRFIGILAFCITVIYMFDVDLADSLSNNLHKISRLVNLFLDDN
FT                   RGFATPALDNLTDFTTILQSGTSSDDLKIVQDTLAVVLQVDDEDATQDDAIYDSDGLQT
FT                   FKQWVSHNQLAGMQLARPLQYPCSTTYGLTADNVAELATSMAQEAKQWSQVVGHTGSGK
FT                   STRLPTAYANCLKGLAGRKKNVLVCEPTRAATVNVTSGISQNFGRLVYGRHEGWSNLGD
FT                   KTIQVMTYGSALAAWKVDNKFLSQFDAVFLDESHLITTHALVFESICQEVTNVRKFYVS
FT                   ATPRDGKKCPEAVRRYEIKTVKSECSSVDTFVRSQDKENSLYVLQHETVLVFLAGKAEC
FT                   DRAASNWNKLYSTNMYAYSLTGDNFTVAYENIVTRMLTDRIIVFCTNILETGVTLNVDC
FT                   VVDFGFTMRPELDLVDKSLTLMRRRVTENERAQRIGRAGRLRTGHAICIGNPETRHDLV
FT                   PPETLYEAALLSFVHGVQFYINEHFENAWIEGVTKSQASVMTQFKLSPFLMRDIVRDDG
FT                   AIPLSLHKILKNYTHRNTDLIGTKLSVMSHVYNSWPLYRTVHQSIFRGDSNVPQALKHA
FT                   RVPFNVSTAHDFPWENFAQACLEFQPRVLQVFSDSSSTSRIINLQIGKMHIVNSMEEVK
FT                   ININSYQRSAENLRSVKDSFESSIFRTKLLRGNPTGKITKRIETLLDNVRVLQQVHAKL
FT                   EIIAYSGGEKLNMDKKSVDELNEIVELQSKNSLTAEELARILHLTKPTSTFFNLFAERG
FT                   RQMLVTLLVMVAASLMYLVFWVSPRKQDDITIEGKGRAYNRDKRMGYDSYEEDEVRHKI
FT                   NKKFKERSTRFSNDSKPETSSKYRNLKQEFVNFYDLKTDANVLQAVFTAMDGAVLLQTE
FT                   APMADIDRVNRLLNDHFEDSESQAAHEGLNTMVKCHLTMKDGRQFELDMEQHDPETIAK
FT                   LGGEVGFRMNRYDLRQVGATRYINPKAQTSAATLEGMTMKPMSAFTIDSAKMVGFIKTA
FT                   KDTLNCILYGDWIIAPAHIQQGEGDITFIFQHTQFTTTTERLASYGIRQFKGLDLVVIR
FT                   RPQQIRAVKKDMRASILDTPTEVQMLYLSTKGGKYQVSTSAVCFPHYNNRWGHVISTAE
FT                   GMCGCIVFNPTTNHIVGIHVSYNDTRRRNEFQAFTSDVLTTINAPGHEIPFSPWVFDWK
FT                   FCGYTTKPRNMQSAPSTLERLNINATGFGFKLNAQGIKPAMLRSTETFSREFPNTQFKL
FT                   IGEVKKGLIDKHTITGENPYFLEFLNTFKPYQWVQAFMDEYAPSILAYDAYFKDLKKYD
FT                   RPPHASVFCEDTLTKAKHKMIKILEEAGMGRTLVRTTEQVLLDMAWTTSGGPLYHGKKI
FT                   DIVQHLSDDELVQFSEACQQALITGTLDGVWNGSLKAELRSSQKILERKTRVFTAAPIT
FT                   SLIAMKYYVDDFNKQFYKTHLKAPHTVGINKFNRGWQNLYEKLNKPGWTHGSGDGSRFD
FT                   SSIDGFLFDVIKDIRKHFMDAEHHKQLDTIYEEIVNTKICLANGLVIQKNCGNNSGQPS
FT                   TVVDNTLALMTSFLYAYARLTGDDTFELMDENFVFVCNGDDNKFAMSPSFMVKFGCDFS
FT                   PFLSELGLTYEFDEATEDICENPYMSLTMVRTSFGIGFSLSIERIVAILQWSRAGGVLH
FT                   AYLSGIAALFESFNTPKLFNLVHTYLLWLVTEHEEELFSMMELKDMFMPLPTKEQIALL
FT                   HYVGTEPIMEETYLQSGKDDPDPIVPPVSDTDLTNMAAAPPDNRRSRAVVPRGTSDWNL
FT                   PEPKMRMLGFKSKINIETLADVPEGYMNTFASVATETQRRKWEEATRGDFGITDNEKWE
FT                   KLLIAACIYFADNGTSPNFDEELTMEVNGGLNSIKEYPVRPFVVRAKKISTLRRIFRCY
FT                   SIETKLMFVKLRRVPQWAIKHGCLDEIVFDFMIPDQFTSRTALETLKQTKLAAIGVGTS
FT                   NSLLTSEQTNMRTTETRRRNDYDGHEALLR"
FT   3'UTR           6923. .7263
FT   polyA_signal    7178. .7182
XX
SQ   Sequence 7263 BP; 2097 A; 1941 C; 1564 G; 1661 T; 0 other;

   D83408  Length: 7263  May 10, 2005 10:09  Type: N  Check: 4295  ..
       1  aaaaataaaa caaaactaca acccaataca aacaacgaac aacaatcaac
      51  gaattcaaaa ctcatcaaag caacatcgct catcagtaac aattcaaacg
     101  aactcaacaa caaaccaccc ttcgaccaaa cgaactctga ccatcaagat
     151  ggaggagttc attcccgaag tgttctacca gaaccaggtt caaagtctca
     201  agaaaattct taaatcctgg aaacgtgaca cttccattta cgcgtatctt
     251  gctcgcgagc aagaggtcct agccttcctt gtactgagtc ctgcgcacat
     301  tgccaaactg aacaaactac tcactgagga gtccgcacga tgcgctctgc
     351  ttgcccaaaa ctgtgaaacc atcgaagctt tagccgttgt gcgacaagcc
     401  ctgcaaggcg tcacgctgca ctttggtgac aatggtatgg aaaaaggctg
     451  gttgcacatg atgaaagcac ttgacgcatg tcttgatgaa agctttagcg
     501  agaacgccgc tgcgctcaag aaaagcatcc aggcggtcgg tcacaagctc
     551  attgcggcaa aaaatcgcat cgaaagttgc gagcgatctg taaatcacct
     601  tacaacgttt caatttgctc gcgaatatgg cttaagtacc acatacttcg
     651  aaaaattgtc caatttcggt gggcatattc gaagttttgt gtggtccagc
     701  gactcaggag aaattttccc aaaaccaaaa agatcatcac gtacgaagcg
     751  catctcgaca ttcacgagct actactgggg tgagttttgg tgcaactgca
     801  tctggctcct ctgttccctg tggtctcccg cacgctggtg ttttaattcc
     851  gtagttttta tttggagtct ttgtggtgtt cttaatttat ctatggttgt
     901  tttgcaattc accctcaagc gtcattttgg tagatactac ttccgctatg
     951  tcatgtctgg tgttttagcc atttgtgccg tttgctgtgt gcatcttaaa
    1001  aatcgaaaag ggcctatact tcaagcctcc caaaaagaca aacgtttcat
    1051  aggaatatta gccttctgca tcactgtcat atacatgttt gatgtggatc
    1101  tcgccgattc gcttagtaat aaccttcata aaatatcccg cctcgtgaac
    1151  ctcttcctgg atgacaaccg cggattcgca acacctgctc ttgacaatct
    1201  aacggacttc acaacaattc ttcaaagtgg aacatcgagt gacgacctaa
    1251  agattgttca ggacacgcta gctgtggttt tacaagtcga cgatgaggac
    1301  gcaactcaag atgacgcaat atacgattcc gacgggcttc agacttttaa
    1351  gcagtgggtc tctcacaacc aactagccgg gatgcaactc gcacgcccac
    1401  tgcaataccc ctgctccacc acctatggcc taactgcaga caatgttgcg
    1451  gaactagcca ctagcatggc acaggaagcg aagcagtggt cacaagttgt
    1501  tggacacact ggttccggaa agtccacacg actaccaact gcatacgcca
    1551  actgtctcaa aggtttggct gggcgaaaga aaaacgtcct cgtttgcgaa
    1601  cccactagag ctgcaaccgt taatgtcacc agcggtatct cgcaaaattt
    1651  cggcaggctc gtctacggac ggcatgaggg ttggagcaac cttggtgaca
    1701  aaacaataca ggtcatgaca tacggctccg cactcgcagc atggaaagtt
    1751  gacaacaaat tcttaagcca gttcgacgca gtgtttctcg acgaatccca
    1801  cctcataacc acgcacgccc ttgttttcga aagcatctgc caggaagtca
    1851  caaacgtccg caagttctat gtgtcagcaa caccccgcga tgggaagaaa
    1901  tgcccagaag ccgtgcgcag atatgaaatc aaaactgtga aatccgagtg
    1951  cagtagcgtc gacactttcg ttcgaagcca agataaggaa aactcgctgt
    2001  acgtcctcca acacgaaact gtacttgttt ttcttgctgg gaaagctgag
    2051  tgcgatagag cagcaagcaa ctggaacaag ctgtactcaa ccaacatgta
    2101  cgcatactcc ctaacaggtg acaacttcac agtggcatac gaaaacattg
    2151  taacacgcat gctcaccgat cgcatcatcg ttttctgtac aaacattctg
    2201  gaaactggcg tcaccctcaa cgtagactgc gttgttgact ttggattcac
    2251  catgcgcccc gaacttgatc ttgttgacaa atcgctcacc ttaatgcggc
    2301  gccgagtcac cgaaaacgag cgcgcacagc gaattgggcg tgcaggaagg
    2351  ctcaggaccg gacacgcaat ttgcattgga aatcctgaaa cgcgccacga
    2401  cctagtccca ccagaaactc tctacgaggc agctcttctc agcttcgtac
    2451  atggcgtgca attctacatc aacgagcatt tcgaaaacgc ctggatcgag
    2501  ggtgtaacaa agtcccaggc ctccgtaatg acgcagttca aactttctcc
    2551  cttcctcatg cgtgacatcg tccgtgatga tggcgcaata ccactatcgc
    2601  tccacaagat actcaagaat tacacacacc gcaacaccga tctgatagga
    2651  acaaaactct ctgtcatgtc gcatgtctat aactcatggc ctctgtatcg
    2701  gacagtgcat caatccatct tccgtggaga ttcaaatgtt ccacaagcgc
    2751  tcaaacacgc acgcgtccct tttaacgtca gcaccgccca tgatttccca
    2801  tgggaaaatt tcgcacaggc atgcctcgaa ttccagccac gtgttcttca
    2851  ggtcttcagt gacagcagca gcacttcgcg cataatcaac ctgcaaatcg
    2901  gtaagatgca catcgtcaat tccatggaag aagtcaagat aaacataaac
    2951  agctatcaac gttctgcaga aaacctacgc tcagtcaagg acagctttga
    3001  gagctccatc ttccgaacaa aactgctccg tggaaaccca actgggaaaa
    3051  taactaagcg cattgaaact ctccttgaca acgtgcgagt gctgcaacag
    3101  gtgcacgcga agctagagat catcgcatac tcaggtggag agaaacttaa
    3151  catggacaag aaatcagtcg acgaacttaa tgagatcgtc gaactccaga
    3201  gcaagaattc actcacagcc gaagagctag cacgcatact gcacctaaca
    3251  aaacccacct ccactttctt caatctcttc gctgaacgtg gccgacaaat
    3301  gctcgtaacc ctcctggtca tggttgccgc ctcgctcatg tacctcgttt
    3351  tctgggtttc cccaaggaaa caggatgaca tcaccatcga gggcaaaggc
    3401  agggcataca accgtgacaa gcgcatgggg tatgattcct acgaggagga
    3451  cgaagttcgc cacaagatca acaagaagtt caaagaacgc agcacaagat
    3501  tctccaatga ctccaagccg gaaacaagct caaagtaccg caacctgaag
    3551  caagagtttg tgaatttcta tgatctcaaa accgatgcga atgtactaca
    3601  agccgtgttc accgcaatgg atggagccgt tcttctgcaa actgaagctc
    3651  caatggcaga cattgatcgt gtcaacagac tgctaaatga tcactttgaa
    3701  gacagcgaaa gccaggctgc acacgaaggt ctcaacacca tggtcaagtg
    3751  tcatttaacc atgaaagacg gaagacagtt tgaactcgac atggaacaac
    3801  acgatcctga gactatcgcc aaacttggag gcgaagttgg tttcaggatg
    3851  aacaggtatg atctacgcca agttggtgcc acacgataca tcaacccaaa
    3901  agcacaaaca tccgcagcaa cgcttgaagg catgaccatg aaaccaatga
    3951  gtgctttcac cattgacagc gcgaagatgg tcggttttat taaaactgca
    4001  aaagacacac tcaactgcat tctatatggc gactggatca tagctcccgc
    4051  acacatacag cagggcgaag gggacataac attcatcttc cagcacacac
    4101  agtttacaac taccaccgag cgtttagcaa gctacgggat tcgacagttc
    4151  aaaggccttg accttgttgt cattcgacgc ccccagcaga tacgcgcagt
    4201  taagaaggac atgcgcgcca gcattcttga cacacccact gaagtgcaaa
    4251  tgctctacct atcaaccaaa ggcggcaagt atcaagtgtc cacgtctgct
    4301  gtgtgtttcc cacactataa caaccgatgg ggacacgtca tttcaacagc
    4351  cgaaggcatg tgcggctgca ttgttttcaa ccccaccaca aaccacattg
    4401  ttgggattca cgtctcctac aatgacacgc gcagaagaaa cgagtttcaa
    4451  gcttttacaa gtgacgttct aacaacaatc aacgcaccag gacacgaaat
    4501  acccttcagt ccatgggttt ttgactggaa gttttgcggg tacacaacga
    4551  aaccacggaa catgcaaagt gcaccaagca cgcttgaacg actcaacatc
    4601  aacgccacag gttttggttt caaactcaat gcacagggga tcaaacctgc
    4651  catgcttcgc tccacagaaa cattctccag ggagttcccg aacacacagt
    4701  tcaagctcat cggagaagtg aagaagggac tcattgataa acacacgatc
    4751  acaggagaga acccctattt ccttgaattc ctcaacacat tcaaaccata
    4801  ccaatgggta caagctttca tggacgagta cgcaccctcc atccttgcct
    4851  acgacgcgta cttcaaggac ttgaagaagt acgataggcc gccacacgca
    4901  agtgtgttct gtgaggacac attgaccaaa gccaaacaca aaatgattaa
    4951  gattctcgaa gaggcaggta tgggcagaac cctagtacga accaccgagc
    5001  aagtcttact tgacatggcc tggaccacct ctggtggacc cttgtaccat
    5051  ggcaagaaga ttgacattgt acaacactta tctgatgatg agcttgtgca
    5101  attcagtgaa gcctgccaac aggctctcat cactggaacg ctagatggag
    5151  tctggaacgg atcactcaaa gccgagctcc gctcttcgca gaagatcctc
    5201  gagcggaaaa ctcgtgtctt cactgctgcc cccataacaa gtctaattgc
    5251  gatgaaatac tacgtggacg atttcaacaa acaattctac aagactcatc
    5301  tcaaagcacc acatacagtt ggtatcaaca agtttaaccg cggatggcag
    5351  aatctctatg agaagctcaa caaacctgga tggacgcatg ggagtgggga
    5401  tggctccagg tttgatagct cgattgatgg attcctcttc gatgtcatca
    5451  aagacatccg aaagcacttc atggatgcag aacaccacaa gcagcttgac
    5501  acaatctatg aagaaattgt taacacgaag atatgtttag caaatggtct
    5551  agtcatccaa aagaattgtg gaaacaatag cggacagccg agcactgtcg
    5601  tcgacaacac actcgcactc atgacttctt ttctttatgc atacgcccga
    5651  ctcactggag atgacacctt tgaactcatg gacgaaaact tcgttttcgt
    5701  ctgcaacggc gacgacaaca agttcgccat gtcacccagc ttcatggtga
    5751  agttcgggtg cgatttctcc ccattccttt ctgagctagg gctaacctac
    5801  gagttcgacg aagccaccga agacatctgt gaaaacccct acatgtcctt
    5851  gaccatggtt cgcacctcgt tcgggatcgg cttctctctc tccatcgaac
    5901  gcatcgttgc aatcctgcaa tggagccgtg ctggtggagt cctgcatgcc
    5951  tatctctctg gcattgctgc tcttttcgag tccttcaaca cacccaaact
    6001  cttcaacctc gtgcacacat acctcctctg gctagtcacg gagcatgagg
    6051  aggaactttt ttcgatgatg gaactcaagg atatgttcat gcctctgccc
    6101  actaaggaac agatagcctt gttgcactac gtaggcactg aacccatcat
    6151  ggaggaaaca tatctgcaat caggaaaaga tgatccagat cccattgttc
    6201  ctccagtttc tgacactgat ctcacaaaca tggctgcagc accacccgac
    6251  aacagaaggt cgcgcgccgt cgtcccccgt gggaccagtg actggaattt
    6301  gcctgaaccc aagatgcgaa tgctaggttt caagtccaaa atcaacatag
    6351  aaacgctcgc cgatgtcccc gaagggtata tgaatacctt tgcgtccgtt
    6401  gcaactgaaa cgcaacgtag gaaatgggaa gaggccacgc gtggtgattt
    6451  tggcatcacc gacaacgaga agtgggaaaa gctgctcatt gctgcctgca
    6501  tatatttcgc agacaatggc acttcaccaa acttcgatga ggagctcact
    6551  atggaagtca atggcggtct caactccatc aaagagtatc ccgtccgccc
    6601  ttttgttgtc agggccaaaa agatctccac actgcgcagg atctttcgct
    6651  gttactccat tgagacgaaa ctaatgttcg tgaagctgag gcgcgtacca
    6701  caatgggcta taaagcacgg gtgccttgat gaaatcgtct tcgatttcat
    6751  gatcccagac cagttcactt ccagaactgc actcgaaaca ctgaagcaga
    6801  ccaagcttgc tgccattggt gttggcacaa gcaattctct cctcacctcc
    6851  gaacagacga acatgagaac cactgaaacc cgaaggcgca acgactacga
    6901  cggtcacgag gcgcttctcc ggtaggtatc tcacacagtt ccatttcctt
    6951  ttcagcaatg catttaaaca cgcttccaat tacatcaagc gtcaagagtt
    7001  gttcccgctt gcagttaatc cttatggggt ggcactttgt gttatgcaat
    7051  ggacagttca atgacgcaat caaccatcat tggttggtga caacgcagca
    7101  tgttctttct tttcacatca agcgacctgc acatcgcccg cttacagcta
    7151  atcctacctg aggatggcac tctgtgttat gtaatggaat gtgcaatctc
    7201  gcaaccaacc gtcattggtt gatggtgcgg ccaaaacccg cactcctgta
    7251  taccggaaag gtt