!!NA_SEQUENCE 1.0
ID   BMD409     standard; RNA; VRL; 3516 BP.
XX
AC   D83409;
XX
SV   D83409.1
XX
DT   22-MAR-1997 (Rel. 51, Created)
DT   07-JUL-2003 (Rel. 76, Last updated, Version 5)
XX
DE   Barley mild mosaic virus complete sequence of genomic RNA2, complete cds.
XX
KW   polyprotein precursor.
XX
OS   Barley mild mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Bymovirus.
XX
RN   [1]
RP   1-3516
RA   Kashiwazaki S.;
RT   ;
RL   Submitted (06-FEB-1996) to the EMBL/GenBank/DDBJ databases.
RL   Satoshi Kashiwazaki, National Agriculture Research Center, Department of
RL   Plant Protection; 3-1-1 Kannondai, Tsukuba, Ibaraki 305-8666, Japan
RL   (E-mail:skashiwa@narc.affrc.go.jp, Tel:81-298-38-8932, Fax:81-298-38-8929)
XX
RN   [2]
RP   1-3516
RA   Kashiwazaki S.;
RT   "The complete nucleotide sequence and genome organization of barley mild
RT   mosaic virus (Na1 strain)";
RL   Unpublished.
XX
RN   [3]
RP   1-3516
RA   Kashiwazaki S.;
RT   "The complete nucleotide sequence and genome organization of barley mild
RT   mosaic virus (Na1 strain)";
RL   Arch. Virol. 141:2077-2089(1996).
XX
DR   GOA; P89684.
DR   SWISS-PROT; P89684; POL2_BAMMN.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3516
FT                   /db_xref="taxon:12466"
FT                   /mol_type="genomic RNA"
FT                   /organism="Barley mild mosaic virus"
FT                   /clone="Na1SK5"
FT                   /strain="Na1"
FT                   /segment="2"
FT   5'UTR           1. .141
FT   CDS             142. .2817
FT                   /codon_start=1
FT                   /db_xref="GOA:P89684"
FT                   /db_xref="SWISS-PROT:P89684"
FT                   /product="polyprotein precursor"
FT                   /protein_id="BAA18954.1"
FT                   /translation="MMMNSTIRQGWQQVLKRFSIPASGDRLIISNPTDQPIGLFGAFDT
FT                   SLQTLSQVGDDPEVLKQKIHIPTHLDIASALEASPRSFPWIFLTNSFCTFGGSIHAQNL
FT                   QAFATAEFKSGFCYMNLLVPLSFDIIDAHADSFRVFVEQLPDMLGAYPSLSMVLNVMLH
FT                   AATRFPEIVSSPVPTIAFDAESLQFHVTDKRGVPGMWNILKAGRVYELLSLAADGVGCE
FT                   YMLYPVGAAPQYSFWKKSMDHFTSDRFVEFLAMQNLLASALEQDYTTHDALDALLAALQ
FT                   NAGYTNVVARERRFPNGHDPSTVWLNLSEAPISEKLTDLKRYLLVGHRSDDTADITHNV
FT                   HQYVFEVLKTMSVQFSKRTNAYNRARFEVNHKVIWNAEYGRGPQQNAELEALVLFLNRQ
FT                   SLEIENILHRTTSPVVVTNWQPDVPTAAPEVSEGEPTHAVATPMTEAPAHATPVEVVNL
FT                   PSTRSYWAETLVGVLTAVLGTIFALLTRALIRAKRLRRKPTFPWVTLDSGDEDDDHSGG
FT                   GGGGPQTPGGQPPASPAHRTHQSRLSVQDIASDTSLLSVDLDEDTLSQYDETFQRIRRA
FT                   LFETSFTDILQNSARWISALEAMALADGNAPYTLLAQYLNGIEEAYTSFRNTGHVSRAT
FT                   LSSFFALEDSLRAAGIAFGATTPTQTIQNQFADSPARRWKTRFEQIACELGDASIKSLA
FT                   DLADIIDTERERSDLTQFDVLAASSISSLCRAVRIISDTTDPDAQLALVENATAMQNNI
FT                   NAILGTNVSIPFLSATRRLLVTRRIQQAGAENRSGATPETIQQLADAELIVSEANMFNE
FT                   MATSQRDIANATQEATIREHVLSPVNALANVGMAAAFFRSGGMRSRALHPAMPTMPGVS
FT                   AATGRPIFQAFRGRGHRLNR"
FT   3'UTR           2815. .3516
FT   polyA_signal    3217. .3221
XX
SQ   Sequence 3516 BP; 922 A; 1008 C; 781 G; 805 T; 0 other;

  D83409  Length: 3516  July 15, 2003 09:22  Type: N  Check: 7838  ..
       1  aaaaataaaa caaaactaca acccaataca aacaacgaac aacaatcaaa
      51  caaacaaaca cacaccaaac acacacagca aaccacagtt tacagctgcg
     101  aaacgcgaac tcacacgctg caatctcaga attgaacaga gatgatgatg
     151  aactccacga ttcgtcaagg atggcagcaa gtgctcaaac gcttttccat
     201  cccagcatcc ggagataggc tcatcatttc caaccccact gatcaaccca
     251  taggtctttt tggagcattc gacacatcgt tgcaaacact ctcgcaggtt
     301  ggtgatgacc ccgaggtttt gaagcagaaa attcacatcc ccacgcacct
     351  ggacatagca tccgcactcg aagccagccc ccggtccttt ccatggattt
     401  tccttacaaa ctccttctgc acctttggtg gttccataca cgcccagaat
     451  ctccaggcct tcgcaaccgc tgagttcaag agcgggttct gttacatgaa
     501  cctgctggtg ccgctcagtt tcgacatcat tgatgcgcac gctgattcct
     551  tccgtgtctt tgttgaacag ctccccgaca tgctaggtgc ctacccttcg
     601  ctcagcatgg tgctaaacgt catgttgcac gcagccacgc gcttccccga
     651  gattgtgagc tcccccgttc caaccatagc attcgacgcc gaatcactgc
     701  agttccacgt gactgataaa cggggcgttc ctggcatgtg gaacatactc
     751  aaagccggcc gcgtatacga gcttctctcg ctcgcagcgg atggcgtggg
     801  ttgtgagtac atgctgtatc ccgttggcgc tgcaccccag tactccttct
     851  ggaagaaatc catggaccat ttcacatctg accggttcgt tgaatttcta
     901  gctatgcaga acctgcttgc tagtgcgctt gaacaggatt acacaacaca
     951  tgacgcactt gatgcattac tagcagctct acagaacgca ggctacacaa
    1001  atgttgtcgc aagggaaaga agattcccaa atggtcacga ccctagcact
    1051  gtctggctaa acctaagtga ggcccccatt tcggagaagc taactgatct
    1101  caaacgatac ctcttagttg gccacagaag cgacgacact gcagacataa
    1151  cacacaacgt acaccagtac gtttttgagg ttcttaaaac catgtctgtt
    1201  cagttcagca aaagaacgaa cgcttacaac cgcgcccgtt tcgaggtcaa
    1251  ccataaggtg atttggaatg cagagtatgg acgcggtccc caacaaaacg
    1301  ccgagcttga agcccttgtt ttgtttctta ataggcaatc gctggagatc
    1351  gagaacattc tgcacaggac aaccagtccc gttgtcgtaa cgaactggca
    1401  acctgatgtt cccactgcag cacctgaagt cagcgaggga gaacccacac
    1451  acgcagtcgc aacacctatg actgaagcgc cagcacacgc aactcctgtt
    1501  gaagttgtga atctgccatc aacacgctct tattgggccg aaacactcgt
    1551  aggcgtgctg actgcagtcc taggaaccat cttcgcctta ctcacccgag
    1601  cactcattcg tgcaaagagg ttgcgaagga agcccacctt cccttgggta
    1651  acactggatt ccggagatga agatgacgac cattctggag ggggaggagg
    1701  tggcccgcaa acacctggcg ggcagccccc agcctcaccg gcgcatagga
    1751  cgcatcagtc acgcctctcc gtgcaagaca tagcatcgga caccagcctg
    1801  ctgagtgtgg accttgacga agacacgctc tcccaatacg acgaaacctt
    1851  ccaaaggatc cgtcgtgcgc tctttgaaac cagtttcaca gacattctgc
    1901  aaaactctgc tcgctggatc tctgcgttag aagcaatggc attagcagat
    1951  ggcaacgccc cttacacgct tctcgcgcaa tacctcaatg gtattgagga
    2001  ggcgtacacg agcttccgta acacgggaca tgtttcgcgc gcaacactct
    2051  caagcttctt cgctttggaa gacagcctac gtgcggctgg catagccttt
    2101  ggagccacga caccaacgca aactatacag aaccagtttg ctgactcccc
    2151  agcccggcgt tggaaaacac gcttcgaaca aatcgcatgc gaattgggcg
    2201  acgctagcat taaatcgctt gccgatcttg cggacatcat cgacaccgag
    2251  cgcgaaagaa gtgacctgac tcagtttgat gttcttgcag cctcttccat
    2301  aagcagcctc tgtcgcgccg ttcgcatcat cagtgacaca actgatccag
    2351  atgcgcaact ggccctcgtt gagaacgcga cagccatgca gaacaacatt
    2401  aacgccatcc tggggacaaa tgttagcata cctttcctca gtgcaacacg
    2451  tcgcctactc gtcacgcgac gcattcagca agccggcgca gaaaatcgtt
    2501  ctggcgcaac acccgaaaca atacagcagc tggctgatgc tgaactaatt
    2551  gtcagcgagg ctaacatgtt caacgagatg gccactagtc agagagatat
    2601  cgccaatgct acacaagagg ccaccattcg tgagcatgtg ctcagtcctg
    2651  tcaatgccct ggcaaatgtt ggcatggctg ctgctttctt ccggtctggc
    2701  ggcatgcgct caagggctct ccaccccgca atgccaacaa tgcctggtgt
    2751  ttctgctgcc acgggacggc caatattcca agcctttaga gggcgaggac
    2801  atcgtctcaa tagatgatga aactctgtgc tcttgcacag cactgaacaa
    2851  gcgacacacg cttgttgtga tagttaattt cacgcacagc gtgccactga
    2901  acaagcgaca cacgcttgtt gtgataatta attaattttt gcgcagattc
    2951  tatctgtgtt ttctagagtg tgctgctctg cagctgcatt ggagggtttc
    3001  acgggaacga catcatcaca ccccatccac aaaccgcctg cattcacata
    3051  ttgtgccact ttaaatactc atacgtatag gcaagtgcct ttctcgcaga
    3101  gcatccctga gtgatggcta ttcacgcgat cgcaatcaac tgacttaatc
    3151  ctcggttttg caatcaaata gtgagttcca cctccggatt tgttccccta
    3201  gaactgcaat cctcgttatg ttgtcgctga ttactatcag ctcgtaaacc
    3251  atgatatcca cccacaatta actactcgtg tactaacagt accggatacg
    3301  cctatcctgc acttaaacct gcaggacgct atcagatccg cctactgtta
    3351  ccatttgtgt agttcgttgt ggttccacct catatctaaa ttcagtacct
    3401  gcatacaaaa cgtcatgcat ccctgttcaa catgaacgcg ggtttgggaa
    3451  gaagcaagtc atcatagact gctggcattg ttaggttgac aatgtttatg
    3501  tacacaggaa cgtgac