ID   FJ621517; SV 1; linear; genomic RNA; STD; VRL; 387 BP.
XX
AC   FJ621517;
XX
DT   22-JUL-2009 (Rel. 101, Created)
DT   09-MAR-2010 (Rel. 104, Last updated, Version 2)
XX
DE   Melon necrotic spot virus isolate PA-3 p7A gene, complete cds; p89 gene,
DE   partial cds; p7B gene, complete cds; and p42 gene, partial cds.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-387
RA   Herrera-Vasquez J.A., Cordoba-Selles M.C., Cebrian M.C., Rossello J.A.,
RA   Alfaro-Fernandez A., Jorda C.;
RT   "Genetic diversity of Melon necrotic spot virus and Olpidium isolates from
RT   different origins";
RL   Plant Pathol. 59(2):240-251(2010).
XX
RN   [2]
RP   1-387
RA   Herrera-Vasquez J.A., Cordoba-Selles Md.C., Cebrian Md.C., Rossello J.A.,
RA   Jorda C.;
RT   ;
RL   Submitted (13-JAN-2009) to the EMBL/GenBank/DDBJ databases.
RL   Ecosistemas Agroforestales, Universidad Politecnica de Valencia, Camino de
RL   Vera s/n, Valencia, Valencia 46022, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .387
FT                   /organism="Melon necrotic spot virus"
FT                   /host="melon"
FT                   /isolate="PA-3"
FT                   /mol_type="genomic RNA"
FT                   /country="Panama:Los Santos"
FT                   /collection_date="2005"
FT                   /db_xref="taxon:11987"
FT   CDS             1. .198
FT                   /codon_start=1
FT                   /product="p7A"
FT                   /note="movement protein"
FT                   /db_xref="GOA:Q8V993"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:Q8V993"
FT                   /protein_id="ACT53337.1"
FT                   /translation="MDSQRTVEQTNPRGRSKERGDSGGKQKNSMGRKIANDAISESKQG
FT                   VMGASTYIADKIKVTINFNF"
FT   CDS             <1. .22
FT                   /codon_start=2
FT                   /product="p89"
FT                   /note="putative RNA-dependent RNA polymerase; produced by a
FT                   readthrough of the p29 amber codon"
FT                   /protein_id="ACT53336.1"
FT                   /translation="WTLNEL"
FT   CDS             202. .387
FT                   /codon_start=1
FT                   /product="p7B"
FT                   /note="movement protein"
FT                   /db_xref="InterPro:IPR009575"
FT                   /db_xref="UniProtKB/TrEMBL:C7ATL5"
FT                   /protein_id="ACT53338.1"
FT                   /translation="MACHRCDSSPGDYSGALLILFISFIFFYITSLSPQGNTYVHHFDN
FT                   SSVKTQYVGISTNGDG"
FT   CDS             374. .>387
FT                   /codon_start=1
FT                   /product="p42"
FT                   /note="coat protein"
FT                   /protein_id="ACT53339.1"
FT                   /translation="MAMV"
XX
SQ   Sequence 387 BP; 118 A; 77 C; 82 G; 110 T; 0 other;

fj621517 Length: 387  09-MAR-2010  Type: N  Check: 3259  ..
       1  atggactctc aacgaactgt agaacaaact aatcctcggg gaagaagtaa
      51  agaacgtggt gacagcgggg gaaaacagaa gaactcaatg gggcgaaaga
     101  tagccaatga tgctatctct gaatcgaagc aaggagtcat gggtgctagc
     151  acatacattg ctgataaaat taaggtgact attaacttta atttttagtg
     201  tatggcttgt caccgttgcg actccagccc cggggattac tctggagcat
     251  tgcttatatt atttatctca tttattttct tctatattac ctcgcttagc
     301  ccgcaaggaa atacttacgt tcatcacttc gataattctt ccgttaaaac
     351  acaatacgtt ggcatctcta caaatggcga tggttaa