!!NA_SEQUENCE 1.0
ID   BAYMVRNA1  standard; RNA; VRL; 7648 BP.
XX
AC   X69757;
XX
SV   X69757.1
XX
DT   08-JAN-1993 (Rel. 34, Created)
DT   25-JAN-1993 (Rel. 34, Last updated, Version 5)
XX
DE   Barley yellow mosaic virus RNA for polyprotein RNA1
XX
KW   capsid protein; helicase; p1 protein; polyprotein; proteinase; replicase;
KW   RNA 1.
XX
OS   Barley yellow mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Bymovirus.
XX
RN   [1]
RP   1-7648
RA   Peerenboom E.;
RT   ;
RL   Submitted (11-DEC-1992) to the EMBL/GenBank/DDBJ databases.
RL   E. Peerenboom, Max-Planck-Institut fuer Zuechtungsforschung,
RL   Carl-von-Linne-Weg 10, 5000 Koeln 30, FRG
XX
RN   [2]
RP   1-7648
RX   MEDLINE; 92268893.
RA   Peerenboom E., Proels M., Schell J., Steinbiss H.H., Davidson A.D.;
RT   "The complete nucleotide sequence of RNA 1 of a german isolate of barley
RT   yellow mosaic virus and its comparison with a japanese isolate";
RL   J. Gen. Virol. 73:1303-1308(1992).
XX
DR   SWISS-PROT; Q04574; POL1_BAYMG.
XX
CC   Barley yellow mosaic virus is a Bymovirus type member.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .7648
FT                   /db_xref="taxon:12465"
FT                   /organism="Barley yellow mosaic virus"
FT                   /strain="BaYMV-G"
FT   CDS             174. .7412
FT                   /db_xref="SWISS-PROT:Q04574"
FT                   /gene="RNA1 BaYMV"
FT                   /product="polyprotein RNA1"
FT                   /product="P1"
FT                   /product="C1 (helicase)"
FT                   /product="NIa (proteinase)"
FT                   /product="NIb (replicase)"
FT                   /product="capsid protein"
FT                   /protein_id="CAA49412.1"
FT                   /translation="MEQTLAQAVSRRGKTNTPMAEERKPFSPMNFSANFVAPELFYSAN
FT                   VRKIKNIFRERSTTRFLDAISSDFELVAFLTLSPAHLMQLETTLRQEIRSCVVPIVTSD
FT                   ASFETVAVIKTALDGMRFHFGHTTLEKGWMSMMRHAESCLQESSSSAVNDLQMQIKRVG
FT                   SLLLSGKNRVESCELSVLNLTARRFRIEYGLNGTYFGEHVAMLLDLKRYIYGTVPKEFC
FT                   WAKTKKHSLFTTPKWIKRTPIDCFLFCLRVIPILHRFGVAISLLYWSCVAALNFPAFMA
FT                   FLFKRQFAKYLAHSFAKHSIYFIFLTIIAILWSFRTFASQKPKIVLQARSTAEKEKKLM
FT                   MILASVVGITYLFDYDIAEALGNCLHKISRLSSYLLDDHQGIASRMFGASYGLQAGDSA
FT                   EDAVTTIISDLLSVTFKIVDEDASQGTVEDASETTFHSWVGVNTLAGRNMSRPLQYDVN
FT                   KTYALTPQNVQLQARAMADANNCWSMVVGHTGSGKSTYLPVQYSNYLSTKSDRRQQILI
FT                   CEPTQAATENVCAGVAANLGRAVYGRHEGWSRMGDHCIQVMTYGSALQCHAMDPSFIST
FT                   FDAIFLDEAHDVKEHSLVFESICDTFKSVRKFYVSATPRDGSVCPEAARKYPLHVETSV
FT                   CDSYRKFIAAQGGGDLLDISKHDTALVFLAGRPECIKAANAWNASVTGEKRAFPLSSDN
FT                   FATDFSMLTERLKTHKTIIFTTNIIETGVTLSVDCVVDFGHTMRPCLDLNQKSLRLDRR
FT                   RVTRNERQQRIGRAGRLKDGYAIVCGDVDRAVNVISPDVLYGAALLSFKHNVPFYMNET
FT                   FESSWLEGVTKAQADTMTIFKLPIFLTRDLINADGSVAREFLDVLKKHQFTTSDIKQAP
FT                   SVTAKHIFPTWASYFSLHQALHYGDDKDEIPHELRYARVPFSVTTLSKFDWPALALACE
FT                   KHRASMSNVFAGIEEPARVVTLQTNPANIQASITHLTHMSKNYKTLIENNQHVRQSMMT
FT                   NVMFKWFSSTRITKDLDRNLRRCTDNLSVVEATLSSLRQILAGNTQVHATPHMQSTLED
FT                   IIELQASDTLTEESLANALGIFVPKCNLFLLLATKGFKLVYVVCILLLVNLVYTGLRKW
FT                   REHLKQKGSNEILTNTMPVSEGGEILAEVMKMEPKMRKNIKRDMDAAVESKLCGFTFVF
FT                   PDDDKIGLEGKGNKYRPREDARLMYSTREDATFDAWNEKAKERRKKVTDKAEPELRRAY
FT                   EKRPYFNFYDLQTDSNILEAIFYTTEGDEFFRTADPNRDMNLVADKLRSFLDTKLVVGH
FT                   HQRKLLEETANVVIKDTKGTAHKMEISQHDPDFLKQNGSGKVGYPEHRGQFRQEGVAVT
FT                   GDYDLEAEFGTDTDEISFGASTGILLSQVGVDVATRVGRICIGTFNMNCYFYSDWILVP
FT                   GHLQDRSGNVTIQFPDQTVQTTTDALNANGVKRFYGLDVIAIRRPAILRPRTKLVKAFA
FT                   IEEPVIAQMVFVDAQGVRKFTQSDWARKEENSGRWSHKISTVLGMCGCPVLDVGKNRLI
FT                   GIHVATNYTKKRNEFQPFTQEVVDFINGPGTKIPYCPWVFDRPACGYSSHNALFEKPTT
FT                   LADVIHMQASDGLHNINNAIEGFGSSLKGQLVSPPTESTRQRFDKLFGSGSFELIGQMN
FT                   KGLIDKHVIVGENDDVYDFMREHPTFTWLKDFMNEYAPSVLSYSAYYKDLCKYNRAKHV
FT                   LTYNPEELHCATKGLIKMLEDAGLTQGSVRTPQQVVSDIQWNTSAGPSYQGKKRDLCAH
FT                   LSDDEVLHLAEVCRQQFLEGKSTGVWNGSLKAELRTIEKVEAEKTRVFTASPITSLFAM
FT                   KFYVDDFNKKFYATNLKAPHTVGINKFGRGWEKLHDKLNRPGWLHGSGDGSRFDSSIDP
FT                   FFFDVVKTIRKHFLPSEHHKAIDLIYDEILNTTICLANGMVIRKNVGNNSGQPSTVVDN
FT                   TLVLMTAFLYAYIHKTGDRELALLNERFIFVCNGDDNKFAISPQFDEEFGHDFSPELVE
FT                   LGLTYEFDDITSDICENPYMSLTMVKTPFGVGFSLPVERIIAIMQWSKKGGVLHSYLAG
FT                   ISAIYESFNTPKLFKSIYAYLLWLTEEHEAEILAAMTQSSTALPIPSMLDVYRLHYGDD
FT                   EIWLQAADPLTDAQKEAAHTAAADRARLDLADADRRRKVEADRVEAARVKKAADAVLKP
FT                   VTLTATRMPTEDDGKLKTPSGARIPSSAADGNWSVPATKQVNAGLTLKIPLNKLKSVPK
FT                   SVMEHNNSVALESELKAWTDAVRTSLGITTDEAWIDALIPFIGWCCNNGTSDKHAENQV
FT                   MQIDSGKGAVTEMSLSPFIVHARMNGGLRRIMRNYSDETVLLITNNKLVAHWSMKHGAS
FT                   ANAKYAFDFFVPRSWMNPQDIEVSKQARLAALGTGTYNTMLTSDTTNLRKTTNHRVLDS
FT                   DGHPELT"
XX
SQ   Sequence 7648 BP; 2150 A; 1769 C; 1714 G; 2015 T; 0 other;

X69757  Length: 7648  December 21, 2001 16:02  Type: N  Check: 1149  ..
       1  aaaaaataaa acaaccctaa accaaaacaa acaaaacgaa acaaacacaa
      51  acatcgcacg cttcccgagc tcacaacacc tgtagagtga tttttgtcat
     101  cctactgttt gtaagctttt cagcaaatca acccgcttgc tttcgcacct
     151  ccttcacctt cactctcgct cttatggagc aaaccctagc tcaagctgtg
     201  tcacggagag gtaaaacaaa cacacctatg gcagaagagc ggaaaccttt
     251  cagccccatg aatttttccg caaactttgt tgctcctgag ctcttttata
     301  gtgctaatgt gaggaaaatt aaaaatatct tcagagagcg cagcacaact
     351  cggtttctgg atgcaatttc aagtgatttt gagctcgttg cttttctcac
     401  tttgagtccc gctcacttaa tgcaacttga gacaactctg cgccaagaaa
     451  tacgttcgtg tgttgtgcca attgttacct ctgatgctag cttcgaaaca
     501  gtcgctgtca tcaaaactgc tctggatggc atgagatttc actttggaca
     551  caccactctt gaaaaggggt ggatgtctat gatgcgccat gcagagagtt
     601  gcctgcaaga gagctcctct tcggctgtga atgatctgca gatgcagatt
     651  aaacgcgttg gatcattgct cttgagtgga aaaaatcgcg tagaaagctg
     701  cgaactatct gtcttgaacc tcacagcgcg acgtttcagg atcgaatatg
     751  ggctaaatgg tacatacttt ggcgaacatg ttgctatgct actcgactta
     801  aagcgttata tctatggtac cgtgccaaaa gagttttgtt gggcgaaaac
     851  caaaaagcac tcgctattca caacccccaa gtggatcaag cgtacgccca
     901  tcgactgttt cttgttctgt cttcgcgtta tccctatctt acataggttt
     951  ggtgtggcca tatcactcct ttactggtcg tgtgttgctg ctctgaattt
    1001  tcctgctttt atggctttct tatttaagcg tcagtttgct aagtatttag
    1051  ctcactcttt tgctaaacac tccatctact ttatattttt aactataatt
    1101  gctattttat ggtcttttcg cacttttgct tctcaaaaac caaaaatagt
    1151  gcttcaggct aggagcacag cagaaaaaga gaaaaagctt atgatgattc
    1201  tagctagtgt cgttgggatc acttatctct tcgattatga catagcagaa
    1251  gctctcggga attgtctaca taaaataagc cgtctatcct catatcttct
    1301  cgacgaccat caaggcatcg catcacgaat gtttggagcg agctatgggc
    1351  ttcaggctgg cgatagtgct gaggatgcag ttacaacgat aatcagcgac
    1401  ctactgtctg ttacttttaa aattgtggac gaagacgcat cacagggcac
    1451  cgtggaggat gcatctgaga caacctttca cagttgggtt ggtgttaaca
    1501  cacttgcagg tcgcaatatg tcaagaccac tccagtatga cgtcaataaa
    1551  acatatgcac tcacacctca aaatgtccag ctccaagcgc gagctatggc
    1601  agacgctaac aactgctggt caatggttgt tggtcataca ggatctggga
    1651  agtcaacata cttacctgtg cagtactcca attacttatc caccaagagt
    1701  gataggcgac agcagattct tatctgcgag ccaactcagg ctgccactga
    1751  gaacgtttgc gctggcgttg ctgccaatct tggcagagct gtttacgggc
    1801  gccatgaggg ttggtccaga atgggggatc attgcattca agttatgacg
    1851  tatggttccg cgctccagtg tcatgctatg gaccctagct tcatatcaac
    1901  tttcgacgca atcttccttg atgaagcaca cgacgtcaaa gagcactctc
    1951  tagtctttga gagcatttgt gacacattta aatccgttcg aaagttctat
    2001  gtttcagcca ctcctagaga tggaagtgta tgtcctgaag cagccaggaa
    2051  atatccttta catgttgaaa ctagcgtttg cgattcgtat cggaagttca
    2101  ttgcagctca aggtggggga gatttgctgg acatctcaaa acatgacaca
    2151  gctttagtct ttctagcagg acggcctgag tgtattaaag ctgctaatgc
    2201  ctggaatgct agtgtcaccg gtgagaagcg cgcctttcct ttgtcaagcg
    2251  acaactttgc taccgacttc tcaatgctca ccgagaggct caaaacacac
    2301  aaaaccatca tcttcaccac gaacataatt gagacaggtg tcactcttag
    2351  cgttgattgt gttgttgatt tcggccatac gatgcgccca tgtttggatc
    2401  tcaatcaaaa atcattacgt cttgatcgac gcagagtgac gcgaaacgaa
    2451  agacagcaga gaattgggcg agcaggtcgg ctcaaagacg ggtacgccat
    2501  agtgtgtgga gatgttgata gggctgtaaa tgtcatctct cctgatgttc
    2551  tttatggtgc cgctcttctg agttttaaac acaatgtgcc tttctacatg
    2601  aacgaaacat ttgagagttc ctggttggag ggtgttacaa aggcacaagc
    2651  tgacacaatg acaatattca agcttcctat atttctaaca cgagacctca
    2701  ttaatgcaga tggctcagtt gctagggagt ttcttgatgt tttaaagaag
    2751  catcaattca caacaagtga cataaagcaa gcaccaagtg tcacagccaa
    2801  acatatcttc ccaacttggg cttcatactt ctctctccat caggcgcttc
    2851  attatggtga tgacaaggat gagataccac acgagttgcg atatgcgcgc
    2901  gttcctttct ccgtcacaac tttgagcaaa ttcgattggc cagccttagc
    2951  tcttgcatgc gagaaacata gagcttccat gtcaaatgtg tttgctggca
    3001  tcgaggaacc cgcacgcgtt gttactctac aaacaaatcc tgcgaacata
    3051  caagcaagca tcacacattt aacgcatatg agcaagaact ataaaactct
    3101  tattgaaaac aaccagcacg tgcgccaatc catgatgacg aatgttatgt
    3151  tcaagtggtt ttcttccact cgcattacca aagatcttga taggaacttg
    3201  cgaagatgca cggataacct ctcagttgtc gaggccacgc ttagctcact
    3251  taggcaaatc ttagctggca acacgcaggt tcacgcaacg ccgcacatgc
    3301  agagcactct tgaggatatt attgaactcc aggctagcga cacactcacg
    3351  gaagaaagct tagcaaacgc acttggcatc tttgtcccaa agtgcaacct
    3401  ctttctgctg ctagctacta aaggtttcaa gcttgtgtac gttgtctgca
    3451  tcttacttct tgtgaacctt gtttacactg gtcttcgtaa gtggcgcgag
    3501  catctcaagc aaaagggaag taacgaaatc ctaactaaca caatgccagt
    3551  tagcgaaggg ggcgaaattc tcgctgaagt tatgaaaatg gagcctaaaa
    3601  tgagaaagaa catcaagagg gatatggatg cagctgttga gagcaaacta
    3651  tgtggcttca cttttgtttt tccagatgat gataaaattg gtcttgaagg
    3701  caagggaaac aaataccgcc ctcgcgaaga cgctcgcctg atgtactcca
    3751  ctagagaaga cgccaccttt gacgcctgga atgagaaagc gaaggaaaga
    3801  cgcaagaaag taaccgacaa agctgagcca gagcttcgca gagcctatga
    3851  gaagagacca tacttcaatt tctacgacct tcaaacagat agcaacattc
    3901  tggaagctat tttctacacc actgaaggtg atgagttttt ccgaacagca
    3951  gaccctaaca gggacatgaa cttggttgct gataaactgc gctcttttct
    4001  cgatacaaag cttgttgttg gacaccatca gcggaagcta ctagaagaaa
    4051  cagccaatgt tgttatcaag gacacgaagg gaactgcgca caagatggaa
    4101  atttcacagc atgatccaga ttttctgaag cagaatgggt ccggcaaagt
    4151  tgggtatcca gaacaccgag gacagtttcg gcaggaagga gttgccgtca
    4201  caggggatta cgatcttgaa gctgagtttg gcaccgatac tgatgaaata
    4251  agctttgggg cctctactgg aattttattg tcacaagttg gggtcgatgt
    4301  tgcaactcga gttggaagaa tttgcattgg cactttcaat atgaactgtt
    4351  acttctatag cgactggatt ctagttccag gacacctgca agatagatct
    4401  ggcaacgtaa caattcaatt ccctgaccaa acagtgcaaa ccacaaccga
    4451  cgcactcaac gcaaatggtg tgaaacgatt ctatggatta gatgtaatag
    4501  caattcgtcg ccctgctatc ttgcggcctc gcaccaagtt ggtcaaagct
    4551  tttgctattg aggaaccagt tatcgcacaa atggtctttg ttgatgcaca
    4601  gggagtccgt aagttcactc aatctgattg ggccaggaag gaggagaatt
    4651  ctgggcgttg gtcacacaag atctccactg ttcttggtat gtgcggatgc
    4701  ccagtcttgg acgttggaaa gaacagatta atagggatcc atgtcgccac
    4751  aaactacaca aagaagcgca acgagttcca acccttcact caggaggttg
    4801  tcgactttat aaatggacct ggaacaaaaa tcccctactg cccatgggta
    4851  tttgatagac cggcttgtgg gtattcatcc cacaacgctt tgttcgagaa
    4901  accaaccaca ctggctgacg tcattcacat gcaggcttct gatggtttgc
    4951  acaacatcaa caatgccatt gagggttttg ggagctcact gaagggtcag
    5001  cttgtgtcac cacctactga atccaccagg caacgtttcg ataagctgtt
    5051  tggtagcggc agctttgagc tcattgggca gatgaacaaa ggcttaatcg
    5101  acaagcacgt gattgttggg gaaaacgatg atgtttatga cttcatgcgc
    5151  gagcacccaa catttacttg gttgaaagat ttcatgaatg aatatgcgcc
    5201  cagtgttttg tcttattctg cttactacaa ggacctttgt aagtataatc
    5251  gtgcaaaaca cgtgctcact tacaacccag aagagctcca ttgtgcgacg
    5301  aaaggactga tcaagatgtt ggaagacgct ggcttgacac aaggcagtgt
    5351  gaggacaccc caacaagttg tttcggacat tcaatggaac acttccgctg
    5401  gaccaagtta tcaagggaag aaacgcgacc tctgtgccca cttgagcgat
    5451  gacgaggtgc tgcatcttgc tgaggtttgt cgtcaacaat ttcttgaggg
    5501  caagtcaact ggagtgtgga acggttctct gaaagctgaa ttgagaacca
    5551  ttgagaaagt tgaggcggag aaaacgcgcg ttttcacagc ctctcccata
    5601  acaagcctgt ttgccatgaa attctacgtt gatgacttta acaagaagtt
    5651  ctatgctacc aatctgaaag ccccccacac tgttggcatc aataagttcg
    5701  gtaggggatg ggaaaaattg catgacaagc ttaatcgccc tggatggttg
    5751  cacggcagtg gggatggttc taggttcgat agctctatcg atcctttctt
    5801  ctttgacgtt gtgaaaacta ttcgtaagca ctttctccct tctgagcatc
    5851  ataaagccat tgatctcata tatgatgaga ttctcaacac aaccatctgc
    5901  ctggctaatg ggatggttat caggaagaat gttggaaaca atagcgggca
    5951  gcctagtact gttgttgaca acacacttgt gcttatgact gcattcctct
    6001  acgcatacat tcacaagaca ggggatcgtg agttagcctt gctaaacgag
    6051  cgtttcatct ttgtttgcaa cggtgatgac aataagtttg ccatatctcc
    6101  gcagtttgat gaagagtttg ggcacgattt ttccccagaa cttgttgaac
    6151  ttggacttac gtatgagttt gatgacatca ctagcgacat ttgcgagaat
    6201  ccttacatgt ccctcactat ggttaaaact ccttttggtg ttggtttctc
    6251  tcttcccgtg gaaagaatca tagccataat gcagtggtcc aagaaagggg
    6301  gggttttgca ctcatattta gctggcatct ctgcaattta cgaatccttc
    6351  aacacaccaa aactcttcaa atcaatctat gcgtaccttc tttggctcac
    6401  tgaggagcac gaggcagaaa ttcttgcagc catgactcaa tcctcaaccg
    6451  cccttcctat accatcaatg ctcgatgttt atcggttgca ctatggtgat
    6501  gatgaaattt ggctgcaagc agctgatcct ctcactgatg cgcaaaaaga
    6551  agctgcacac actgccgcag ctgatagagc acgcctcgac ctagccgacg
    6601  ctgaccgtag acgtaaagtt gaagctgacc gtgtggaagc ggcaagagtc
    6651  aaaaaggcag ctgatgctgt gctaaaacca gttaccctca cagcaacacg
    6701  catgcccaca gaagatgatg gcaaacttaa aacgccatct ggtgctagaa
    6751  taccatcatc agctgcagat ggtaactgga gcgtgccggc aacgaagcaa
    6801  gttaacgctg gtttaacact caaaattccc ctgaataagc tcaaaagtgt
    6851  gcctaagtct gttatggaac ataacaactc agttgcactt gaatctgagc
    6901  taaaagcctg gactgatgct gtgcgcacaa gtttgggtat cacaactgat
    6951  gaggcatgga tcgatgccct catacccttc atcggatggt gctgcaacaa
    7001  tggcacctca gacaagcatg ctgagaatca agtaatgcaa attgacagcg
    7051  gaaagggagc tgtcacagag atgagtctgt ccccatttat tgttcatgct
    7101  cgaatgaatg gtggactccg aaggatcatg cgtaactaca gtgatgaaac
    7151  cgtcttactc atcacaaaca acaaactagt tgcacattgg tcaatgaagc
    7201  atggcgcttc tgcaaatgca aaatatgctt tcgatttctt cgtcccacga
    7251  tcatggatga acccacagga catcgaagta tcaaagcaag cgcgcttagc
    7301  agcacttgga actggaacgt ataacaccat gttaacttcc gacactacca
    7351  atctgcgtaa gacaaccaac cacagggttc tggactcaga tggacaccca
    7401  gaactaacct aaaccatcac cccgtgcctt atacatcacc cacccccact
    7451  cataattcag tctttaaatt atgttcgtga cgtctttgta tcaggctcgg
    7501  aacggttcta tgatccatat gcctttggca gttacaatgt cagcattctc
    7551  attgaggagt atgacagcgt tgatcagccg ttttcaatca tccgtcgttg
    7601  gatggtggtg cacttagtgc acttacgagt accagaaggt aataaaaa