Sequence of DPV Mungbean yellow mosaic India virus

Mungbean yellow mosaic India virus-[Bogra] AV2 gene, isolate 1

ACC No: AM087116

Dated: 2007-04-06 | Length: 539 | CRC: 1204915913

                
ID   AM087116; SV 1; linear; genomic DNA; STD; VRL; 539 BP.
XX
AC   AM087116;
XX
DT   22-SEP-2005 (Rel. 85, Created)
DT   06-APR-2007 (Rel. 91, Last updated, Version 2)
XX
DE   Mungbean yellow mosaic India virus-[Bogra] AV2 gene, isolate 1
XX
KW   AV2 gene; AV2 protein.
XX
OS   Mungbean yellow mosaic India virus-[Bogra]
OC   Viruses; ssDNA viruses; Geminiviridae; Begomovirus.
XX
RN   [1]
RP   1-539
RA   Maruthi M.N.;
RT   ;
RL   Submitted (19-SEP-2005) to the EMBL/GenBank/DDBJ databases.
RL   Maruthi M.N., Natural Resources Institute, University of Greenwich, Central
RL   Avenue, Chatham Maritime, Kent, ME4 4TB, UNITED KINGDOM.
XX
RN   [2]
RA   Maruthi M.N., Rekha A.R., Mirza S.H., Alam S.N., Colvin J.;
RT   "PCR-based detection and partial genome sequencing indicate high genetic
RT   diversity in Bangladeshi begomoviruses and their whitefly vector, Bemisia
RT   tabaci";
RL   Virus Genes 34(3):373-385(2007).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .539
FT                   /organism="Mungbean yellow mosaic India virus-[Bogra]"
FT                   /segment="DNA-A"
FT                   /specific_host="Vigna unguiculata subsp. sesquipedalis"
FT                   /isolate="1"
FT                   /mol_type="genomic DNA"
FT                   /country="Bangladesh:Bogra"
FT                   /isolation_source="yard-long-bean"
FT                   /virion
FT                   /db_xref="taxon:346671"
FT   CDS             156. .497
FT                   /transl_table=1
FT                   /gene="AV2"
FT                   /product="AV2 protein"
FT                   /db_xref="InterPro:IPR002511"
FT                   /db_xref="UniProtKB/TrEMBL:Q3MPY4"
FT                   /protein_id="CAJ31400.1"
FT                   /translation="MWDPLLNDFPNSLHGFRCMLAIKYLQQVQENYPSNSRGFMYLTGL
FT                   IQVLRIRNHAKADLRYSLLYPDIECTEEIELRNPAPAPCICGRCPYQPEKKALDQPTHV
FT                   EETSVLPTV"
XX
SQ   Sequence 539 BP; 130 A; 131 C; 127 G; 151 T; 0 other;

am087116 Length: 539  06-APR-2007  Type: N  Check: 1467  ..

       1  accggtgggc cgcgcgaccg gtgtattggg gttgctttaa ctttaatgct
      51  tttttggtac ccttatcttt agtcgttcaa tcaggagcgc tcctcagcgc
     101  tatgttaatt caaatttgaa ttataaagca agtggacact ctgaacccac
     151  taacaatgtg ggatcctttg ttgaacgact ttcccaattc attgcatgga
     201  ttccggtgca tgttggctat aaagtatttg cagcaagttc aagagaatta
     251  tccatctaat tctcgtggtt ttatgtacct tacagggtta attcaggtat
     301  tgcgcatccg gaatcatgcc aaagcggacc tacgatacag ccttctctac
     351  cccgatatcg aatgcacgga ggagattgaa cttcgaaacc ccgctcctgc
     401  tccctgcatc tgcgggaggt gtccctacca acctgaaaag aaggcgttgg
     451  accaaccgac ccatgtggag gaaacctcgg ttttaccgac tgtataggtc
     501  ccctgatgtc cctcggggtt gtgaagggcc atgcaaagt