Sequence of DPV Chicory yellow mottle virus satellite RNA

Chicory yellow mottle virus satellite RNA gene for hypothetical protein, complete cds.

ACC No: D00721

Dated: 2007-12-15 | Length: 457 | CRC: 1261790463

                
ID   D00721; SV 1; linear; genomic RNA; STD; VRL; 457 BP.
XX
AC   D00721;
XX
DT   04-SEP-1992 (Rel. 33, Created)
DT   15-DEC-2007 (Rel. 94, Last updated, Version 8)
XX
DE   Chicory yellow mottle virus satellite RNA gene for hypothetical protein,
DE   complete cds.
XX
KW   .
XX
OS   Chicory yellow mottle virus satellite RNA
OC   Viruses; Satellites; Satellite Nucleic Acids;
OC   Single stranded RNA satellites; Circular single stranded RNA satellites.
XX
RN   [1]
RP   1-457
RX   PUBMED; 1698918.
RA   Rubino L., Tousignant M.E., Steger G., Kaper J.M.;
RT   "Nucleotide sequence and structural analysis of two satellite RNAs
RT   associated with chicory yellow mottle virus";
RL   J. Gen. Virol. 71:1897-1903(1990).
XX
DR   RFAM; RF00173.
XX
CC   These data kindly submitted in computer readable form by:
CC   Luisa Rubino
CC   Consiglio Nazionale delle Ricerche
CC   Via Amendola 165/A
CC   70126 Bari
CC   Italy
CC   The plus strand is shown here.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .457
FT                   /organism="Chicory yellow mottle virus satellite RNA"
FT                   /mol_type="genomic RNA"
FT                   /note="satellite RNA S1"
FT                   /db_xref="taxon:192022"
FT   misc_structure  1. .46
FT                   /note="hammerhead structure"
FT   misc_signal     complement(39. .54)
FT                   /note="self-cleavage consensus sequence"
FT   CDS             224. .376
FT                   /codon_start=1
FT                   /product="hypothetical protein"
FT                   /note="ORF"
FT                   /db_xref="UniProtKB/TrEMBL:Q66094"
FT                   /protein_id="BAA00623.1"
FT                   /translation="MQTGANHTRMVPDNIPHMVCFPGALRCCMCKSGSASRSWATVLLG
FT                   TRFSI"
FT   misc_signal     complement(255. .306)
FT                   /note="self-cleavage consensus sequence"
FT   misc_structure  450. .457
FT                   /note="hammerhead structure"
XX
SQ   Sequence 457 BP; 94 A; 118 C; 130 G; 115 T; 0 other;

d00721 Length: 457  15-DEC-2007  Type: N  Check: 3534  ..

       1  gccagacgtg gacccggcct gatgagtccg aaaggacgaa acagtactgc
      51  gctaagaggt gagactactt caatcctctt atgaccttcc ctgctgatgt
     101  tacctgggat ttatcctgtg gtaagggtat aggacggtcc taccatacgt
     151  gctccacgag tgtattcctc gtgatgagcg gtgggggggt cccgttatgg
     201  ggtccagccg gcgacgcatt tctatgcaga ccggtgcaaa ccacacgcgt
     251  atggtgccag ataatatacc acacatggtg tgtttccctg gcgcgcttcg
     301  ctgttgtatg tgtaagtcgg gctcagcctc ccgcagctgg gcgacggttc
     351  tacttggtac ccgattttca atttgagagt tgggctacca acggaacttt
     401  cgtccgtgcg gtagggtggg cttgccctga aaacaaccac ctatcaagat
     451  tactgtc