Sequence of DPV Tomato leaf curl New Delhi virus

Tomato leaf curl New Delhi virus from papaya AC4 protein gene, complete cds.

ACC No: EU006071

Dated: 2007-08-28 | Length: 177 | CRC: -1330952934

                
ID   EU006071; SV 1; linear; genomic DNA; STD; VRL; 177 BP.
XX
AC   EU006071;
XX
DT   19-AUG-2007 (Rel. 92, Created)
DT   28-AUG-2007 (Rel. 93, Last updated, Version 2)
XX
DE   Tomato leaf curl New Delhi virus from papaya AC4 protein gene, complete
DE   cds.
XX
KW   .
XX
OS   Tomato leaf curl New Delhi virus
OC   Viruses; ssDNA viruses; Geminiviridae; Begomovirus.
XX
RN   [1]
RP   1-177
RA   Praveen S., Mishra A.K., Mangrauthia S.K., Jain R.K.;
RT   ;
RL   Submitted (29-JUN-2007) to the EMBL/GenBank/DDBJ databases.
RL   Division of Plant Pathology, Indian Agricultural Research Institute, IARI,
RL   New Delhi, New Delhi 110012, India
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .177
FT                   /organism="Tomato leaf curl New Delhi virus"
FT                   /specific_host="papaya"
FT                   /mol_type="genomic DNA"
FT                   /country="India:New Delhi"
FT                   /db_xref="taxon:223347"
FT   CDS             1. .177
FT                   /codon_start=1
FT                   /product="AC4 protein"
FT                   /note="RNAi suppressor; pathogenicity determinant"
FT                   /protein_id="ABU40641.1"
FT                   /translation="MGLRISMFSSNSKGNSSAKITDSSTWFPQVGQHISIRTFRELNQR
FT                   QMSKHTSTKTETF"
XX
SQ   Sequence 177 BP; 54 A; 44 C; 36 G; 43 T; 0 other;

eu006071 Length: 177  28-AUG-2007  Type: N  Check: 709  ..

       1  atgggtctcc gcatatccat gttctcatcc aattcgaagg gaaattccag
      51  tgcaaaaata acagattctt cgacttggtt tccccaagtc ggtcagcaca
     101  tttccatccg aacattcagg gagctaaatc agcgtcagat gtcaaagcat
     151  acatcgacaa agacggagac gttctag