Sequence of DPV Strawberry mild yellow edge virus

Strawberry mild yellow edge virus isolate sy03 triple gene block protein 3 (TGB3) gene, partial cds; and nonfunctional coat protein (cp) gene, complete sequence.

ACC No: EU107085

Dated: 2007-08-29 | Length: 878 | CRC: 1098582478

                
ID   EU107085; SV 1; linear; genomic RNA; STD; VRL; 878 BP.
XX
AC   EU107085;
XX
DT   29-AUG-2007 (Rel. 93, Created)
DT   29-AUG-2007 (Rel. 93, Last updated, Version 1)
XX
DE   Strawberry mild yellow edge virus isolate sy03 triple gene block protein 3
DE   (TGB3) gene, partial cds; and nonfunctional coat protein (cp) gene,
DE   complete sequence.
XX
KW   .
XX
OS   Strawberry mild yellow edge virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Flexiviridae;
OC   Potexvirus.
XX
RN   [1]
RP   1-878
RA   Yang H.;
RT   "Sequence diversity of the 3' terminal genome for Strawberry mild yellow
RT   edge virus";
RL   Unpublished.
XX
RN   [2]
RP   1-878
RA   Yang H., Zhang Z.;
RT   ;
RL   Submitted (04-AUG-2007) to the EMBL/GenBank/DDBJ databases.
RL   College of Horticulture, Shenyang Agricultural University, Shenyang,
RL   Liaoning 110161, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .878
FT                   /organism="Strawberry mild yellow edge virus"
FT                   /isolate="sy03"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /virion
FT                   /db_xref="taxon:12187"
FT   gene            <1. .154
FT                   /gene="TGB3"
FT   CDS             <1. .154
FT                   /codon_start=2
FT                   /gene="TGB3"
FT                   /product="triple gene block protein 3"
FT                   /protein_id="ABU63407.1"
FT                   /translation="IIALVSNSGCYVHFDGRSATSTCPPGPWLEPIASGLYTAGLARPH
FT                   PEPQC"
FT   gene            45. .716
FT                   /gene="cp"
FT   misc_feature    45. .716
FT                   /gene="cp"
FT                   /note="nonfunctional coat protein due to mutation"
XX
SQ   Sequence 878 BP; 177 A; 283 C; 205 G; 212 T; 1 other;

eu107085 Length: 878  29-AUG-2007  Type: N  Check: 9274  ..

       1  catcatcgcc ctggtcagta attcaggttg ttacgtacac ttcgatggga
      51  gatcagccac gtccacctgt ccccccggcc cctggctcga acccattgct
     101  tccgggctct ataccgccgg tcttgccagg ccgcaccccg aaccccaatg
     151  ctaacgtctc caattctgtt ggggatcctt tcagggtgtt gacgccagag
     201  gagctcgcga caccaatcgc tgccgctagc aacaaagtgg ccacccgcga
     251  gcagattctc gccattgtag ccgacttgaa cgctcttggc ttcgttggag
     301  atcccgccat tggacttttc gacttagcct tccactgcta cgacattggc
     351  tcctctccct ctgcacaacc ggtcggaccc tcgcccttcg gctgctcacg
     401  catgcaagtc gccgccgtcg tgagaaatca ttgcacactt cgccagctct
     451  gcatgttcta tgcacccagt gtgtggaaca aggctgtccg ggacaatcgt
     501  ccccctggca attggagtaa ccttcagttc actcccgaga ccaagtttgc
     551  cgcatttgat ttcttcgatg gtgtgctcaa tcccgccagc caggccgttg
     601  ctttgtggcg ccnacccacc ccgcaggaga tatacgcttc agccacgcac
     651  aaggatgtag ctacttatcg tgctgccagt agggcacacg accgcatttc
     701  aaattcacgc tcctgactaa aggagctagt aaatcgactc cgcccgcttt
     751  actggccggg ccccgacgct taacgtgggt cgatttggct taaaatggga
     801  gtttcttctc acttcttcta cccagctcca atgagtgcca tgaagtgaat
     851  atagtactac ttaaccgtac tagtatag