Sequence of DPV Strawberry mild yellow edge virus
Strawberry mild yellow edge virus isolate sy03 triple gene block protein 3 (TGB3) gene, partial cds; and nonfunctional coat protein (cp) gene, complete sequence.
ACC No: EU107085
Dated: 2007-08-29 | Length: 878 | CRC: 1098582478
ID EU107085; SV 1; linear; genomic RNA; STD; VRL; 878 BP.
XX
AC EU107085;
XX
DT 29-AUG-2007 (Rel. 93, Created)
DT 29-AUG-2007 (Rel. 93, Last updated, Version 1)
XX
DE Strawberry mild yellow edge virus isolate sy03 triple gene block protein 3
DE (TGB3) gene, partial cds; and nonfunctional coat protein (cp) gene,
DE complete sequence.
XX
KW .
XX
OS Strawberry mild yellow edge virus
OC Viruses; ssRNA positive-strand viruses, no DNA stage; Flexiviridae;
OC Potexvirus.
XX
RN [1]
RP 1-878
RA Yang H.;
RT "Sequence diversity of the 3' terminal genome for Strawberry mild yellow
RT edge virus";
RL Unpublished.
XX
RN [2]
RP 1-878
RA Yang H., Zhang Z.;
RT ;
RL Submitted (04-AUG-2007) to the EMBL/GenBank/DDBJ databases.
RL College of Horticulture, Shenyang Agricultural University, Shenyang,
RL Liaoning 110161, China
XX
FH Key Location/Qualifiers
FH
FT source 1. .878
FT /organism="Strawberry mild yellow edge virus"
FT /isolate="sy03"
FT /mol_type="genomic RNA"
FT /country="China"
FT /virion
FT /db_xref="taxon:12187"
FT gene <1. .154
FT /gene="TGB3"
FT CDS <1. .154
FT /codon_start=2
FT /gene="TGB3"
FT /product="triple gene block protein 3"
FT /protein_id="ABU63407.1"
FT /translation="IIALVSNSGCYVHFDGRSATSTCPPGPWLEPIASGLYTAGLARPH
FT PEPQC"
FT gene 45. .716
FT /gene="cp"
FT misc_feature 45. .716
FT /gene="cp"
FT /note="nonfunctional coat protein due to mutation"
XX
SQ Sequence 878 BP; 177 A; 283 C; 205 G; 212 T; 1 other;
eu107085 Length: 878 29-AUG-2007 Type: N Check: 9274 ..
1 catcatcgcc ctggtcagta attcaggttg ttacgtacac ttcgatggga
51 gatcagccac gtccacctgt ccccccggcc cctggctcga acccattgct
101 tccgggctct ataccgccgg tcttgccagg ccgcaccccg aaccccaatg
151 ctaacgtctc caattctgtt ggggatcctt tcagggtgtt gacgccagag
201 gagctcgcga caccaatcgc tgccgctagc aacaaagtgg ccacccgcga
251 gcagattctc gccattgtag ccgacttgaa cgctcttggc ttcgttggag
301 atcccgccat tggacttttc gacttagcct tccactgcta cgacattggc
351 tcctctccct ctgcacaacc ggtcggaccc tcgcccttcg gctgctcacg
401 catgcaagtc gccgccgtcg tgagaaatca ttgcacactt cgccagctct
451 gcatgttcta tgcacccagt gtgtggaaca aggctgtccg ggacaatcgt
501 ccccctggca attggagtaa ccttcagttc actcccgaga ccaagtttgc
551 cgcatttgat ttcttcgatg gtgtgctcaa tcccgccagc caggccgttg
601 ctttgtggcg ccnacccacc ccgcaggaga tatacgcttc agccacgcac
651 aaggatgtag ctacttatcg tgctgccagt agggcacacg accgcatttc
701 aaattcacgc tcctgactaa aggagctagt aaatcgactc cgcccgcttt
751 actggccggg ccccgacgct taacgtgggt cgatttggct taaaatggga
801 gtttcttctc acttcttcta cccagctcca atgagtgcca tgaagtgaat
851 atagtactac ttaaccgtac tagtatag