Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus isolate PA-1 p7A gene, complete cds; p89 gene, partial cds; p7B gene, complete cds; and p42 gene, partial cds.

ACC No: GQ228387

Dated: 2009-09-24 | Length: 387 | CRC: -2010496769

                
ID   GQ228387; SV 1; linear; genomic RNA; STD; VRL; 387 BP.
XX
AC   GQ228387;
XX
DT   24-SEP-2009 (Rel. 102, Created)
DT   24-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Melon necrotic spot virus isolate PA-1 p7A gene, complete cds; p89 gene,
DE   partial cds; p7B gene, complete cds; and p42 gene, partial cds.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-387
RA   Herrera-Vasquez J.A., Cordoba-Selles Md.C., Jorda C.;
RT   "Occurrence, distribution and molecular analysis of Melon necrotic spot
RT   virus and Olpidium bornovanus in field-grown cucurbit crops of Panama";
RL   Unpublished.
XX
RN   [2]
RP   1-387
RA   Herrera-Vasquez J.A., Cordoba-Selles Md.C., Jorda C.;
RT   ;
RL   Submitted (02-JUN-2009) to the EMBL/GenBank/DDBJ databases.
RL   Ecosistemas Agroforestales, Universidad Politecnica de Valencia, Camino de
RL   Vera s/n, Valencia 46022, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .387
FT                   /organism="Melon necrotic spot virus"
FT                   /host="melon"
FT                   /isolate="PA-1"
FT                   /mol_type="genomic RNA"
FT                   /country="Panama"
FT                   /collection_date="2006"
FT                   /db_xref="taxon:11987"
FT   CDS             1. .198
FT                   /codon_start=1
FT                   /product="p7A"
FT                   /note="movement protein"
FT                   /protein_id="ACV87229.1"
FT                   /translation="MDSQRTVEQTNPRGRSKERGDSGGKQKNSMGRKIANDAISESKQG
FT                   VMGASTYIADKIKVTINFNF"
FT   CDS             <1. .22
FT                   /codon_start=2
FT                   /product="p89"
FT                   /note="putative RNA-dependent RNA polymerase; produced by a
FT                   readthrough of the p29 amber codon"
FT                   /protein_id="ACV87228.1"
FT                   /translation="WTLNEL"
FT   CDS             202. .387
FT                   /codon_start=1
FT                   /product="p7B"
FT                   /note="movement protein"
FT                   /protein_id="ACV87230.1"
FT                   /translation="MACYRCDSSPGDYSGALLILFISFVFFYITSLSPQGNTYVHHFDN
FT                   SSVKTQYVGISTNGDG"
FT   CDS             374. .>387
FT                   /codon_start=1
FT                   /product="p42"
FT                   /note="coat protein"
FT                   /protein_id="ACV87231.1"
FT                   /translation="MAMV"
XX
SQ   Sequence 387 BP; 117 A; 78 C; 83 G; 109 T; 0 other;

gq228387 Length: 387  24-SEP-2009  Type: N  Check: 4041  ..

       1  atggactctc aacgaactgt agaacaaact aatcctcggg gaaggagtaa
      51  agaacgtggt gacagcgggg gaaaacagaa gaactcaatg gggcgaaaga
     101  tagccaatga tgctatctct gaatcgaagc aaggagttat gggtgctagt
     151  acatacattg ctgacaaaat taaggtaact atcaacttta atttttagtg
     201  catggcttgt taccgctgtg actccagccc cggggattac tctggagcat
     251  tgcttatatt atttatctca ttcgttttct tttatattac ctcgcttagc
     301  ccgcaaggaa atacttacgt tcatcacttc gataattctt ccgtcaaaac
     351  acaatacgtt ggcatctcta caaatggcga tggttaa