Sequence of DPV Cucumber mosaic virus satellite RNA

Cucumber mosaic virus CARNA 5 gene with ORFs I, IIA, and IIB, 5' end, clone X15.

ACC No: M20357

Dated: 2000-03-04 | Length: 336 | CRC: -1728292127

                !!NA_SEQUENCE 1.0
ID   CUMCVC06   standard; RNA; VRL; 336 BP.
XX
AC   M20357;
XX
SV   M20357.1
XX
DT   20-FEB-1989 (Rel. 18, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Cucumber mosaic virus CARNA 5 gene with ORFs I, IIA, and IIB, 5' end, clone
DE   X15.
XX
KW   .
XX
OS   cucumber mosaic virus (cucumber mosaic cucumovirus)
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Bromoviridae;
OC   Cucumovirus.
XX
RN   [1]
RP   1-336
RX   MEDLINE; 88179532.
RA   Kaper J.M., Tousignant M.E., Steen M.T.;
RT   "Cucumber mosaic virus-associated RNA 5: XI. Comparison of 14 CARNA 5
RT   variants relates ability to induce tomato necrosis to a conserved
RT   nucleotide sequence";
RL   Virology 163:284-292(1988).
XX
DR   SPTREMBL; Q89474; Q89474.
DR   SPTREMBL; Q89492; Q89492.
DR   SPTREMBL; Q89781; Q89781.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .336
FT                   /db_xref="taxon:12305"
FT                   /organism="cucumber mosaic virus"
FT   CDS             11. .94
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q89492"
FT                   /note="ORF I"
FT                   /protein_id="AAA46403.1"
FT                   /translation="MENCAEGLYLREDLSLGGVGYLPAKAG"
FT   CDS             98. .169
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q89474"
FT                   /note="ORF IIA"
FT                   /protein_id="AAA46404.1"
FT                   /translation="MFPRTGDRWLASYVRYSQYYTLI"
FT   CDS             135. .248
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q89781"
FT                   /note="ORF IIB"
FT                   /protein_id="AAA46405.1"
FT                   /translation="MSATLSTTLSFEPPLSLLAEPGTWFADTMDFSKETLC"
XX
SQ   Sequence 336 BP; 68 A; 80 C; 95 G; 93 T; 0 other;

 M20357  Length: 336  December 21, 2001 15:54  Type: N  Check: 4323  ..

       1  gttttgtttg atggagaatt gcgcagaggg gttatatctg cgtgaggatc
      51  tgtcactcgg cggtgtggga tacctccctg ctaaggcggg ttgagtgatg
     101  ttccctcgga ctggggaccg ctggcttgcg agttatgtcc gctactctca
     151  gtactacact ctcatttgag cccccgctca gtttgctagc agaacccggc
     201  acatggttcg ccgataccat ggatttttcg aaagaaacac tctgttaggt
     251  ggtatgagtc atgacgcaca cagggagagg ctaaggctta tgctatgctg
     301  atctccgtga atgtctatca ttcctatgca ggaccc